• Featured Product
  • KD/KO Validated

SNRPB2 Polyclonal antibody

SNRPB2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 13512-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

U2 snRNP B'', U2 snRNP B, U2 small nuclear ribonucleoprotein B''

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human brain tissue, human kidney tissue, human liver tissue, mouse liver tissue, mouse lung tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13512-1-AP targets SNRPB2 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4436

Product name: Recombinant human SNRPB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-225 aa of BC036737

Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Predict reactive species
Full Name small nuclear ribonucleoprotein polypeptide B''
Calculated Molecular Weight 225 aa, 26, 5 kDa
Observed Molecular Weight25-31 kDa
GenBank Accession NumberBC036737
Gene Symbol SNRPB2
Gene ID (NCBI) 6629
RRIDAB_2302390
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08579
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

U2 small nuclear ribonucleoprotein B''(SNRPB2) is part of the U2 RNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. Only in presence of the U2A' protein, SNRPB2 binds stem loop IV of U2 snRNA.

Protocols

Product Specific Protocols
IF protocol for SNRPB2 antibody 13512-1-APDownload protocol
IHC protocol for SNRPB2 antibody 13512-1-APDownload protocol
IP protocol for SNRPB2 antibody 13512-1-APDownload protocol
WB protocol for SNRPB2 antibody 13512-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

CPEB1 coordinates alternative 3'-UTR formation with translational regulation.

Authors - Felice-Alessio Bava
humanWB,IHC

Sci Transl Med

Comment on "Drug screening for ALS using patient-specific induced pluripotent stem cells".

Authors - Bilada Bilican
humanIF

Sci Transl Med

Drug screening for ALS using patient-specific induced pluripotent stem cells.

Authors - Naohiro Egawa
humanWB

Nucleic Acids Res

Stoichiometries of U2AF35, U2AF65 and U2 snRNP reveal new early spliceosome assembly pathways.

Authors - Li Chen
humanWB

Cell Chem Biol

Novel RNA-Affinity Proteogenomics Dissects Tumor Heterogeneity for Revealing Personalized Markers in Precision Prognosis of Cancer.

Authors - Li Wang
humanWB

STAR Protoc

Protocol for proteogenomic dissection of intronic splicing enhancer interactome for prediction of individualized cancer prognosis.

Authors - Li Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Melissa (Verified Customer) (03-16-2020)

This antibody works incredibly robust in western blot analysis. However, we do observe a non-specific band in all of our blots which we have attributed to snRPA due to the size and sequence similarity of the immunogen.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa Cell Nuclear Extract
FH

John (Verified Customer) (12-06-2018)

  • Applications: Western Blot,
  • Cell Tissue Type: HeLa
SNRPB2 Antibody Western Blot, validation ( dilution) in HeLa (Cat no:13512-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...