Filter: AllWBIHC

WB analysis of MCF-7 using 10379-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 10379-1-AP (SNRPD3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of MCF-7 using 10379-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 10379-1-AP (SNRPD3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IHC staining of human small intestine using 10379-1-AP
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human small intestine using 10379-1-AP
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human lung cancer using 10379-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 10379-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human lung cancer using 10379-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 10379-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 10379-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens).

SNRPD3 Polyclonal antibody

Name: SNRPD3 Polyclonal antibody
Brand: Proteintech
SKU: 10379-1-AP

SNRPD3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10379-1-AP

Publications(2)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Sm D3, SMD3, snRNP core protein D3, SNRPD3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	MCF7 cells, MCF-7 cells
Positive IHC detected in	human small intestine tissue, human breast cancer tissue, human lung cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 1 publications below
IHC	See 1 publications below

Product Information

10379-1-AP targets SNRPD3 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0293 Product name: Recombinant human SNRPD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-119 aa of BC000457 Sequence: EGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRG Predict reactive species
Full Name	small nuclear ribonucleoprotein D3 polypeptide 18kDa
Calculated Molecular Weight	18 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC000457
Gene Symbol	SNRPD3
Gene ID (NCBI)	6634
RRID	AB_2286308
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P62318
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Small nuclear ribonucleoprotein D3 polypeptide 18kDa (SNRPD3,synonym: SMD) belongs to the small nuclear ribonucleoprotein core protein family, with molecular weights of the D members: D1,16 kDa; D2, 16.5 kDa and D3 18 kDa. SNRPD3 is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.

Protocols

Product Specific Protocols
IHC protocol for SNRPD3 antibody 10379-1-AP	Download protocol
WB protocol for SNRPD3 antibody 10379-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Biochem Biophys Res Commun CRISPR-based RNA-binding protein mapping in live cells. Authors - Baiwen Chen View Article
human	IHC	Transl Oncol Identification of genes associated with local aggressiveness and metastatic behavior in soft tissue tumors. Authors - Cunha Isabela Werneck IW View Article