SPATA2 Recombinant monoclonal antibody

SPATA2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 85712-1-RR
Clone No.242523H4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

KIAA0757, PD1, spermatogenesis associated 2, Spermatogenesis-associated protein 2, tamo

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, Raji cells, PC-3 cells, A549 cells, mouse testis tissue
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85712-1-RR targets SPATA2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30773

Product name: Recombinant human SPATA2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 330-520 aa of BC009481

Sequence: STQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPASKPSAFPSKASTHDSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVYR

Predict reactive species
Full Name spermatogenesis associated 2
Calculated Molecular Weight 58 kDa
Observed Molecular Weight58-60 kDa
GenBank Accession NumberBC009481
Gene Symbol SPATA2
Gene ID (NCBI) 9825
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UM82
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
FC protocol for SPATA2 antibody 85712-1-RRDownload protocol
IHC protocol for SPATA2 antibody 85712-1-RRDownload protocol
WB protocol for SPATA2 antibody 85712-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...