Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ST3GAL5 Polyclonal antibody

ST3GAL5 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

ST3GAL5, ST3GalV, UNQ2510/PRO5998, CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase, EC:2.4.3.9, Lactosylceramide alpha-2,3-sialyltransferase, SIAT9, SIATGM3S, ST3Gal V

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ST3GAL5 in ?

Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, HeLa cells, human testis tissue, human placenta tissue
Positive IHC detected inmouse skeletal muscle tissue, human skeletal muscle tissue, human skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14614-1-AP targets ST3GAL5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6207

Product name: Recombinant human ST3GAL5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 88-418 aa of BC065936

Sequence: TTEECDMKKMHYVDPDRVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF

Predict reactive species
Full Name ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC065936
Gene Symbol ST3GAL5
Gene ID (NCBI) 8869
RRIDAB_2194414
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UNP4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ST3GAL5 is also named as SIAT9, GM3 synthase, ST3Gal V, Sialyltransferase 9 and belongs to the glycosyltransferase 29 family. ST3GAL5 transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the non-reducing terminal galactose of glycosphingolipids forming gangliosides (PMID:9822625, PMID:16934889). SIAT9 is mainly involved in the biosynthesis of ganglioside GM3 but can also use different glycolipids as substrate acceptors such as D-galactosylceramide (GalCer), asialo-GM2 (GA2) and asialo-GM1 (GA1) (PMID:16934889). ST3GAL5 is highly expressed in brain, skeletal muscle, placenta, and testis. And mRNA of ST3GAL5 is widely distributed in human brain, but slightly elevated expression was observed in the cerebral cortex, temporal lobe, and putamen (PMID:9822625). ST3GAL5 has 3 isoforms with the molecular mass of 45, 46, and 48 kDa. Sometimes the band of 70 kDa can also be observed, which may be a glycosylated form of ST3GAL5 (PMID: 34943806, PMID: 26458842).

Protocols

Product Specific Protocols
IHC protocol for ST3GAL5 antibody 14614-1-APDownload protocol
WB protocol for ST3GAL5 antibody 14614-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-ST3GAL5 antibody (Cat# 14614-1-AP) has 8 citations published in journals including Cell Reports, Frontiers in Immunology, Cancer Cell International, International Immunopharmacology, Frontiers in Cell and Developmental Biology, ACS Omega, iScience, and Molecular Oncology. Research fields span oncology (renal cell carcinoma, bladder cancer, lung cancer), glycobiology/sialylation, tumor microenvironment, vascular smooth muscle biology, and aortic aging. Applications include WB, IHC, and IF.

SpeciesApplicationTitle

Cell Rep

Time-resolved proteolipidomics of the human aorta identifies stage-specific lipid-protein modules across development and aging.

Authors - Hao Cui
humanIHC

Front Immunol

Identification of ST3GAL5 as a prognostic biomarker correlating with CD8+ T cell exhaustion in clear cell renal cell carcinoma

Authors - Jiakuan Liu
humanWB,IHC,IF

Cancer Cell Int

Comprehensive analysis of α2,3-sialyltransferases as prognostic biomarkers and immunotherapy targets in kidney renal clear cell carcinoma

Authors - Yuli Jian
humanWB,IHC

Int Immunopharmacol

Identification and validation of sialyltransferase ST3Gal5 in bladder cancer through bioinformatics and experimental analysis

Authors - Yuli Jian
humanWB

Front Cell Dev Biol

PRC2-dependent regulation of ganglioside expression during dedifferentiation contributes to the proliferation and migration of vascular smooth muscle cells

Authors - Norihiko Sasaki
humanIHC

ACS Omega

Novel Biomarkers for Lymph Node Metastasis and Prognosis of Bladder Cancer by Bioinformatics Analysis.

Authors - Yifan Sun
Loading...
||
New chat

Able™

正在加载,请稍候...