Tested Applications
| Positive WB detected in | SH-SY5Y cells, THP-1 cells, mouse pancreas tissue, Caco-2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17942-1-AP targets Neurokinin-1 receptor in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12368 Product name: Recombinant human TACR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 304-407 aa of BC074911 Sequence: IYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS Predict reactive species |
| Full Name | tachykinin receptor 1 |
| Calculated Molecular Weight | 407 aa, 46 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC074911 |
| Gene Symbol | Neurokinin-1 receptor |
| Gene ID (NCBI) | 6869 |
| RRID | AB_2200611 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25103 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
neurokinin 1 receptor (NK1R, also known as the tachykinin 1 receptor, TACR1), a mediator of behavioral stress responses, in alcohol dependence and treatment. One such neurotransmitter is substance P (SP), which together with its preferred TACR1 is highly expressed in brain areas involved in stress responses and drug reward, including the hypothalamus, amygdala, and nucleus accumbens (PMID: 18276852).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Neurokinin-1 receptor antibody 17942-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Neurokinin-1 receptor Polyclonal antibody (Cat# 17942-1-AP) has 9 citations. These appear in journals including Nature Cell Biology, Journal of Nanobiotechnology, Phytomedicine, Environmental Pollution, Pharmaceutical Biology, Peptides, Journal of Neuroimmunology, PLoS ONE, and Neoplasma. Associated research fields span pancreatic cancer, depression/nanomedicine, traditional Chinese medicine mechanisms, pubertal development, allergic airway inflammation, pain/analgesia, neuroinflammation, and gastric cancer progression.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Psychological stress-induced ALKBH5 deficiency promotes tumour innervation and pancreatic cancer via extracellular vesicle transfer of RNA | ||
J Nanobiotechnology Targeting microglial circMBNL1 unlocks a novel nanomedicine therapeutic strategy for major depressive disorder. | ||
Phytomedicine Differential effect of polysaccharide and nonpolysaccharide components in Sijunzi decoction on spleen deficiency syndrome and their mechanisms. | ||
Environ Pollut Phenanthrene exposure disrupts puberty onset in SD rats by influencing hypothalamic neural networks | ||
Pharm Biol Stigmasterol alleviates allergic airway inflammation and airway hyperresponsiveness in asthma mice through inhibiting substance-P receptor | ||
Peptides Study on the distribution sites and the molecular mechanism of analgesia after intracerebroventricular injection of rat/mouse hemokinin-1 in mice. |
