Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TIMM17B Polyclonal antibody

TIMM17B Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

DXS9822, JM3, Mitochondrial import inner membrane translocase subunit Tim17-B, TIM17B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TIMM17B in ?

Tested Applications

Positive WB detected inmouse heart tissue, mouse liver tissue, PC-3 cells
Positive IP detected inPC-3 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11062-1-AP targets TIMM17B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1504

Product name: Recombinant human TIMM17B protein

Source: e coli.-derived, PKG

Tag: GST

Domain: 1-172 aa of BC010142

Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

Predict reactive species
Full Name translocase of inner mitochondrial membrane 17 homolog B (yeast)
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 17-20 kDa
GenBank Accession NumberBC010142
Gene Symbol TIMM17B
Gene ID (NCBI) 10245
RRIDAB_2201995
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60830
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for TIMM17B antibody 11062-1-APDownload protocol
IP protocol for TIMM17B antibody 11062-1-APDownload protocol
WB protocol for TIMM17B antibody 11062-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-TIMM17B antibody (Cat# 11062-1-AP) has 10 total citations spanning journals including Cell Metabolism, Molecular Cell, Cell Reports, Journal of Cell Biology, Scientific Reports, American Journal of Physiology, Cancer Research Communications, Infection and Immunity, and Cellular and Molecular Biology. Research fields cover mitochondrial protein import/translocation, metabolic regulation, immune cell function, Sengers syndrome, and cancer biology.

SpeciesApplicationTitle
mouseWB

Cell Metab

Acylglycerol Kinase Maintains Metabolic State and Immune Responses of CD8+ T Cells.

Authors - Zhilin Hu
humanWB

Mol Cell

Acylglycerol Kinase Mutated in Sengers Syndrome Is a Subunit of the TIM22 Protein Translocase in Mitochondria.

Authors - Milena Vukotic
humanWB

Mol Cell

Sengers Syndrome-Associated Mitochondrial Acylglycerol Kinase Is a Subunit of the Human TIM22 Protein Import Complex.

Authors - Yilin Kang
human

Cell Rep

TIM23 facilitates PINK1 activation by safeguarding against OMA1-mediated degradation in damaged mitochondria

Authors - Shiori Akabane
humanWB

J Cell Biol

ROMO1 is a constituent of the human presequence translocase required for YME1L protease import.

Authors - Frank Richter

Sci Rep

The presence of disulfide bonds reveals an evolutionarily conserved mechanism involved in mitochondrial protein translocase assembly.

Authors - Lidia Wrobel

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The product has one review from Angela Zhu (December 2024). She used lot 00018765 for Western Blot on heart tissue at a 1:1000 dilution and rated it 4 out of 5 stars, commenting simply "good." Overall, the limited feedback suggests satisfactory performance in WB applications, though the sample size is too small to draw broad conclusions about consistency or reliability across different conditions.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Angela (Verified Customer) (12-27-2024)

good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: heart tissue
TIMM17B Antibody Western Blot validation (1:1000 dilution) in heart tissue (Cat no:11062-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...