TMEM9B Polyclonal antibody

TMEM9B Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24331-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse

Applications

WB, IHC, ELISA

C11orf15, TMEM9 domain family, member B, TMEM9B, Transmembrane protein 9B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat liver tissue, mouse colon tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24331-1-AP targets TMEM9B in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples.

Tested Reactivity human, rat, mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19383

Product name: Recombinant human TMEM9B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 80-172 aa of BC040124

Sequence: PDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKV

Predict reactive species
Full Name TMEM9 domain family, member B
Calculated Molecular Weight 198 aa, 23 kDa
Observed Molecular Weight 23 kDa, 35 kDa
GenBank Accession NumberBC040124
Gene Symbol TMEM9B
Gene ID (NCBI) 56674
RRIDAB_2879497
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NQ34
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM9B, also termed as Transmembrane protein 9B encodes a 198 amino-acidprotein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites, and three conserved cys-rich domains in the N-terminus. There is a dimer form of TMEM9B protein (PMID: 12359240). TMEM9B mRNA is expressed in a wide range of tissues and cells. TMEM9B is a lysosomal transmembrane protein that regulates the activity of inflammatory signaling pathways.

Protocols

Product Specific Protocols
IHC protocol for TMEM9B antibody 24331-1-APDownload protocol
WB protocol for TMEM9B antibody 24331-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

Nat Commun

Endosomal chloride/proton exchangers need inhibitory TMEM9 β-subunits for regulation and prevention of disease-causing overactivity

Authors - Rosa Planells-Cases
Loading...
||
New chat Able
正在加载,请稍候...