TMOD2 Polyclonal antibody

TMOD2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 15262-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

N TMOD, Neuronal tropomodulin, NTMOD, TMOD2, Tropomodulin 2, tropomodulin 2 (neuronal)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue, human brain tissue, human colon tissue, mouse brain tissue, mouse colon tissue, mouse testis tissue
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2400
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

15262-1-AP targets TMOD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7262

Product name: Recombinant human TMOD2 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-351 aa of BC064961

Sequence: MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR

Predict reactive species
Full Name tropomodulin 2 (neuronal)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC064961
Gene Symbol TMOD2
Gene ID (NCBI) 29767
RRIDAB_2256189
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NZR1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for TMOD2 antibody 15262-1-APDownload protocol
WB protocol for TMOD2 antibody 15262-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Biol Chem

Transforming growth factor beta 1 alters the 3'UTR of mRNA to promote lung fibrosis.

Authors - Junsuk Ko
Loading...
||
New chat Able
正在加载,请稍候...