×
Use Able AI chat for product recommendations
  • KD/KO Validated

Tissue Factor/CD142 Recombinant monoclonal antibody

Tissue Factor/CD142 Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 83887-4-RR
Clone No.240875H3
Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, 240875H3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using Tissue Factor Recombinant antibody (83887-4-RR)

    WB analysis using 83887-4-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 83887-4-RR (Coagulation Factor III/Tissue Factor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of mouse brain tissue using Tissue Factor Recombinant antibody (83887-4-RR)

    WB analysis of mouse brain using 83887-4-RR

    mouse brain tissue were subjected to SDS PAGE followed by western blot with 83887-4-RR (Coagulation Factor III/Tissue Factor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of NIH/3T3 cells using Tissue Factor/CD142 Recombinant monoclonal antibod (83887-4-RR)

    WB analysis of NIH/3T3 using 83887-4-RR

    WB result of Tissue Factor/CD142 antibody (83887-4-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Tissue Factor/CD142 transfected NIH/3T3 cells.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Affinity and Kinetic Characterization of 83887-4-RR

    Affinity and Kinetic Characterization of 83887-4-RR

    Biolayer interferometry (BLl) kinetic assays of 83887-4-RR against Mouse Tissue Factor were performed. The affinity constant is 0.85 nM.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Tested Applications

Positive WB detected inA431 cells, mouse brain tissue, NIH/3T3 cells, SH-SY5Y cells, rat skin tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83887-4-RR targets Tissue Factor/CD142 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1102

Product name: Recombinant Mouse Tissue Factor protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 29-251 aa of

Sequence: AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE

Predict reactive species
Full Name coagulation factor III
Calculated Molecular Weight33 kDa
Observed Molecular Weight48-53 kDa
Gene Symbol Tissue Factor
Gene ID (NCBI) 14066
RRIDAB_3671470
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20352
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108). This antibody is specific for mouse Tissue Factor.

Protocols

Product Specific Protocols
WB protocol for Tissue Factor/CD142 antibody 83887-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseELISA

Biol Pharm Bull

Coagulation and Fibrinolysis Profiles in Mouse Breast Cancer 4T1 Tumor-Bearing Mice: A Characterization of Neutrophil-Associated Prothrombotic States.

Authors - Riyo Morimoto-Kamata
View Article
||
New chat

Able™

正在加载，请稍候...