UQCRC2 Recombinant monoclonal antibody

UQCRC2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83667-2-RR
Clone No.240454D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

Ubiquinol-cytochrome-c reductase complex core protein 2, QCR2, Cytochrome b-c1 complex subunit 2, mitochondrial, Core protein II, Complex III subunit 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HEK-293 cells, Jurkat cells, HeLa cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83667-2-RR targets UQCRC2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6432

Product name: Recombinant human UQCRC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 103-453 aa of BC000484

Sequence: IEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

Predict reactive species
Full Name ubiquinol-cytochrome c reductase core protein II
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC000484
Gene Symbol UQCRC2
Gene ID (NCBI) 7385
RRIDAB_3671273
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP22695
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UQCRC2(Ubiquinol-cytochrome-c reductase complex core protein 2) is also named as complex III subunit 2,core protein II and belongs to the UQCRC2/QCR2 subfamily. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske/UQCRFS1), 2 core proteins (UQCRC1/QCR1 and UQCRC2/QCR2) and 6 low-molecular weight proteins (UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and a cleavage product of Rieske/UQCRFS1) and is part of the mitochondrial respiratory chain. This protein distributes in mitochondrion inner membrane, peripheral membrane protein and matrix side.

Protocols

Product Specific Protocols
FC protocol for UQCRC2 antibody 83667-2-RRDownload protocol
IHC protocol for UQCRC2 antibody 83667-2-RRDownload protocol
WB protocol for UQCRC2 antibody 83667-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Adv Sci (Weinh)

Phosphorylation of POU3F3 Mediated Nuclear Translocation Promotes Proliferation in Non-Small Cell Lung Cancer through Accelerating ATP5PF Transcription and ATP Production

Authors - Qi-Gang Zeng
Loading...
||
New chat Able
正在加载,请稍候...