Filter: AllWBIPIHCIF/ICC

WB analysis of HEK-293 using 16389-1-AP
WB result of Ku80 antibody (16389-1-AP, 1:4000) with si-Control and si-Ku80 transfected HEK-293 cells.
WB analysis of HepG2 using 16389-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 16389-1-AP (XRCC5/Ku80 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 16389-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 16389-1-AP (XRCC5/Ku80 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of K-562 using 16389-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 16389-1-AP (XRCC5/Ku80 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of A431 using 16389-1-AP
A431 cells were subjected to SDS PAGE followed by western blot with 16389-1-AP (XRCC5/Ku80 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of human liver using 16389-1-AP
human liver tissue were subjected to SDS PAGE followed by western blot with 16389-1-AP (XRCC5/Ku80 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 16389-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 16389-1-AP (XRCC5/Ku80 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IP experiment of HEK-293 using 16389-1-AP
IP result of anti-XRCC5/Ku80 (IP:16389-1-AP, 4ug; Detection:16389-1-AP 1:1000) with HEK-293 cells lysate 1200ug.
IHC staining of human colon cancer using 16389-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16389-1-AP (XRCC5/Ku80 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 16389-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16389-1-AP (XRCC5/Ku80 antibody at dilution of 1:50 (under 10x lens).
IHC staining of human lung cancer using 16389-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16389-1-AP (XRCC5/Ku80 antibody at dilution of 1:50 (under 40x lens).
IHC staining of human colon cancer using 16389-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16389-1-AP (XRCC5/Ku80 antibody at dilution of 1:50 (under 10x lens).
IHC staining of human colon cancer using 16389-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16389-1-AP (XRCC5/Ku80 antibody at dilution of 1:50 (under 40x lens).
IF Staining of HepG2 using 16389-1-AP
Immunofluorescent analysis of HepG2 cells, using XRCC5 antibody 16389-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).
IF Staining of HeLa using 16389-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using XRCC5/Ku80 antibody (16389-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

Featured Product
KD/KO Validated

XRCC5/Ku80 Polyclonal antibody

XRCC5/Ku80 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16389-1-AP

Publications(35)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

Synonyms

KU80, XRCC5, double-strand-break rejoining, CTCBF, CTC85

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (35)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HepG2 cells, K-562 cells, HEK-293 cells, A431 cells, human liver tissue, HeLa cells
Positive IP detected in	HEK-293 cells
Positive IHC detected in	human colon cancer tissue, human lung cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells, HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:600-1:2400
Immunofluorescence (IF)/ICC	IF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 2 publications below
WB	See 30 publications below
IHC	See 2 publications below
IF	See 7 publications below
IP	See 5 publications below
CoIP	See 1 publications below
ChIP	See 1 publications below
RIP	See 2 publications below

Product Information

16389-1-AP targets XRCC5/Ku80 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9454 Product name: Recombinant human XRCC5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 384-732 aa of BC019027 Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI Predict reactive species
Full Name	X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Calculated Molecular Weight	732 aa, 83 kDa
Observed Molecular Weight	80-83 kDa
GenBank Accession Number	BC019027
Gene Symbol	XRCC5
Gene ID (NCBI)	7520
RRID	AB_2257509
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P13010
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

There are at least two pathways for eukaryotes to repair DNA double-strand breaks: homologous recombination and nonhomologous end joining(NHEJ). The core NHEJ machinery includes XRCC4, DNA ligase IV and the DNA-dependent protein kinase complex, which consists of the DNA end-binding XRCC5/XRCC6 heterodimer and the catalytic subunit PRKDC. The heterdimer of XRCC5/XRCC6 enhanced teh affinity of the catalytic subunit PRKDC to DNA by 100-fold. Once the XRCC5/6 dimer association with NAA15, it can bind to the osteocalcin promoter and activate osteocalcin expression. The XRCC5/6 dimer acts as a negative regulator of transcription when together with APEX1. Some publised papers indicated that the MW of XRCC5 is 86kDa, while more papers suggested that XRCC5 is a 80kDa protein, as it was firstly introducted in publication. Thus, Ku80 and Ku86 are the same protein.

Protocols

Product Specific Protocols
IF protocol for XRCC5/Ku80 antibody 16389-1-AP	Download protocol
IHC protocol for XRCC5/Ku80 antibody 16389-1-AP	Download protocol
IP protocol for XRCC5/Ku80 antibody 16389-1-AP	Download protocol
WB protocol for XRCC5/Ku80 antibody 16389-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
mouse,human	WB,IP	Immunity Cytoplasmic DNA sensing by KU complex in aged CD4+ T cell potentiates T cell activation and aging-related autoimmune inflammation. Authors - Yan Wang View Article
human	IF	Oncogene UBE2S, a novel substrate of Akt1, associates with Ku70 and regulates DNA repair and glioblastoma multiforme resistance to chemotherapy. Authors - L Hu View Article
human,mouse	WB,IHC,IP	Phytomedicine Kaempferol inhibits non-homologous end joining repair via regulating Ku80 stability in glioma cancer Authors - Meiyang Chen View Article
human	WB	J Mater Chem B Hollow PtCo alloy nanospheres as a high-Z and oxygen generating nanozyme for radiotherapy enhancement in non-small cell lung cancer Authors - Shuying Li View Article
human	IF	Mol Med Nuclear VPS35 attenuates NHEJ repair by sequestering Ku protein Authors - Luping Zhang View Article
human	WB	FEBS J Radiation resistance of cancer cells caused by mitochondrial dysfunction depends on SIRT3-mediated mitophagy Authors - Yan Wei View Article