Tested Applications
| Positive WB detected in | HeLa cells, HepG cells, HEK-293 cells, A549 cells, K-562 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
80325-6-RR targets XRCC5/Ku80 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag9454 Product name: Recombinant human XRCC5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 384-732 aa of BC019027 Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI Predict reactive species |
| Full Name | X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) |
| Calculated Molecular Weight | 732 aa, 83 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | BC019027 |
| Gene Symbol | XRCC5 |
| Gene ID (NCBI) | 7520 |
| RRID | AB_3670474 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P13010 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
There are at least two pathways for eukaryotes to repair DNA double-strand breaks: homologous recombination and nonhomologous end joining(NHEJ). The core NHEJ machinery includes XRCC4, DNA ligase IV and the DNA-dependent protein kinase complex, which consists of the DNA end-binding XRCC5/XRCC6 heterodimer and the catalytic subunit PRKDC. The heterdimer of XRCC5/XRCC6 enhanced teh affinity of the catalytic subunit PRKDC to DNA by 100-fold. Once the XRCC5/6 dimer association with NAA15, it can bind to the osteocalcin promoter and activate osteocalcin expression. The XRCC5/6 dimer acts as a negative regulator of transcription when together with APEX1. Some publised papers indicated that the MW of XRCC5 is 86kDa, while more papers suggested that XRCC5 is a 80kDa protein, as it was firstly introducted in publication.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for XRCC5/Ku80 antibody 80325-6-RR | Download protocol |
| IF protocol for XRCC5/Ku80 antibody 80325-6-RR | Download protocol |
| IHC protocol for XRCC5/Ku80 antibody 80325-6-RR | Download protocol |
| WB protocol for XRCC5/Ku80 antibody 80325-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The XRCC5/Ku80 Recombinant monoclonal antibody (catalog number 80325-6-RR) has 2 citations. These appear in the journals Oncogene (impact factor 9.1) and Cell Signal (impact factor 4.7). The research fields involve DNA repair and cancer biology: one study examines vimentin intermediate filaments in DNA nonhomologous end joining repair and lipolysis, while the other explores BMP5's role in suppressing clear cell renal cell carcinoma progression through DNA damage response signaling. Both studies used the antibody for Western blot, with one also employing IP and IF, in human samples.
| Species | Application | Title |
|---|---|---|
Oncogene Vimentin intermediate filaments orchestrate DNA nonhomologous end joining repair and lipolysis after DNA damage | ||
Cell Signal BMP5 suppresses malignant progression of clear cell renal cell carcinoma by promoting DNA damage accumulation and sustained DNA damage response signaling. |
