B23/NPM1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• B23/NPM1 Monoclonal antibody (60096-1-Ig)

• Featured Product
• KD/KO Validated

B23/NPM1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60096-1-Ig

Clone No.4F12A3

Publications(64)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

B23, NPM1, 4F12A3, NPM, Nucleophosmin

• 

  WB analysis using 60096-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60096-1-Ig (B23/NPM1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 60096-1-Ig

  WB result of B23/NPM1 antibody (60096-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-B23/NPM1 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 60096-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 60096-1-Ig (B23 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 60096-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60096-1-Ig (B23/NPM1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 60096-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 60096-1-Ig (B23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 60096-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 60096-1-Ig (B23 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of ROS1728 using 60096-1-Ig

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 60096-1-Ig (B23 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 60096-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 60096-1-Ig (B23 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 60096-1-Ig

  C6 cells were subjected to SDS PAGE followed by western blot with 60096-1-Ig (B23 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 60096-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60096-1-Ig (B23 Antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 60096-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60096-1-Ig (B23 Antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 60096-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60096-1-Ig (B23/NPM1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 60096-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60096-1-Ig (B23/NPM1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 60096-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60096-1-Ig (B23 Antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 60096-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60096-1-Ig (B23 Antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 60096-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using B23/NPM1 antibody (60096-1-Ig, Clone: 4F12A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 60096-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using B23/NPM1 antibody (60096-1-Ig, Clone: 4F12A3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 60096-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using B23/NPM1 antibody (60096-1-Ig, Clone: 4F12A3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HSC-T6 cells, C6 cells, HeLa cells, HepG2 cells, LNCaP cells, NIH/3T3 cells, RAW 264.7 cells, ROS1728 cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human breast cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60096-1-Ig targets B23/NPM1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7415

  Product name: Recombinant human B23 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-293 aa of BC002398

  Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS

• Full Name: nucleophosmin (nucleolar phosphoprotein B23, numatrin)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC002398
• Gene Symbol: NPM1
• Gene ID (NCBI): 4869
• RRID: AB_2155162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P06748
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; PKMYT1 kinase ameliorates cisplatin sensitivity in osteosarcoma; Authors - Binfeng Liu
human	WB	J Hepatol; Nucleolin lactylation contributes to intrahepatic cholangiocarcinoma pathogenesis via RNA splicing regulation of MADD; Authors - Long Yang
human	WB	Nat Metab; Myc-mediated SDHA acetylation triggers epigenetic regulation of gene expression and tumorigenesis.; Authors - Shi-Ting Li
human	WB,IF	Mol Neurodegener; Nuclear speckle specific hnRNP D-like prevents age- and AD-related cognitive decline by modulating RNA splicing.; Authors - Qingyang Zhang
human	IP	Autophagy; The protease activity of human ATG4B is regulated by reversible oxidative modification.; Authors - Xueping Zheng
human	WB,IF	Nat Commun; ASO therapy rescues NOTCH2NLC GGC repeat expansion-induced genomic damage, 3D chromatin structural abnormalities, and senescence.; Authors - Mengjie Li

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Tatyana (Verified Customer) (12-04-2023)

Was used for nucleolar staining, very strong specific signal

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human / HeLa cells

B23/NPM1 Antibody Immunofluorescence validation (1:1000 dilution) in Human / HeLa cells (Cat no:60096-1-Ig)