FcZero-rAb® Biotin Anti-Human IL-10RB Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Human IL-10RB Rabbit Recombinant Antibody (Biotin-FcA98292)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

IL-10RB FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98292 Copied!

Clone No. 242302D2

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC, ELISA

Synonyms

IL10RB, CDW210B, CRF2 4, CRF2-4, CRFB4

• 

  FC experiment of human PBMCs using Biotin-FcA98292

  1x10^6 human PBMCs were surface stained with FcZero-rAb™ APC Anti-Human HLA-DR (L243) Rabbit IgG Recombinant Antibody (APC-FcA65560, Clone: L243), and 0.25 ug Biotin Anti-Human IL-10RB Rabbit RecAb (Biotin-FcA98292, Clone: 242302D2) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using Biotin-FcA98292

  1x10^6 human PBMCs were surface stained with 0.25 ug Biotin Anti-Human IL-10RB Rabbit RecAb (Biotin-FcA98292, Clone: 242302D2) (red) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9)(blue), and Streptavidin-PE Conjugate (PE-PF00030).Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-10RB in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98292 targets IL-10RB in FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3446

  Product name: Recombinant Human IL-10RB protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-220 aa of BC001903

  Sequence: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS

• Full Name: interleukin 10 receptor, beta
• Calculated Molecular Weight: 37 kDa
• GenBank Accession Number: BC001903
• Gene Symbol: IL10RB
• Gene ID (NCBI): 3588
• RRID: AB_3747025
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08334
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RB, also known as IL-10R2 or CDw210b, is the signaling subunit of the IL-10R complex and is constitutively expressed in a variety of cell types (PMID: 24507158). Binding of IL-10 to the IL-10R complex leads to JAK1- and TYK2-mediated phosphorylation of STAT3 (PMID: 11244051; 10433356). IL-10RB is also shared by several other cytokines, including IL22, IL-26, IFN-γ, IL-28A/B and IL29 (PMID: 22236434).