Use Able AI chat for product recommendations

Cytokeratin 2e Polyclonal antibody

Cytokeratin 2e Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

KRT2, CK 2, CK 2e, CK2, CK-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Cytokeratin 2e in ?

Tested Applications

Positive WB detected inA431 cells, mouse skin tissue, rat skin tissue.
Positive IHC detected inhuman cervical cancer tissue, human oesophagus cancer tissue, mouse colon tissue, mouse skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21725-1-AP targets Cytokeratin 2e in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16384

Product name: Recombinant human KRT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 210-331 aa of BC096294

Sequence: WELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDT

Predict reactive species
Full Name keratin 2
Calculated Molecular Weight 639 aa, 66 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC096294
Gene Symbol KRT2
Gene ID (NCBI) 3849
RRIDAB_2878914
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35908
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18).Keratin 2 is a type II cytokeratin. It is found largely in the upper spinous layer of epidermal keratinocytes, and also in other regions, notably the epidermis covering the knee, thigh, and groin.

Protocols

Product Specific Protocols
IHC protocol for Cytokeratin 2e antibody 21725-1-APDownload protocol
WB protocol for Cytokeratin 2e antibody 21725-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Cytokeratin 2e Polyclonal antibody (Cat# 21725-1-AP) has 2 citations. These appear in Journal of Dermatological Science and Contact Lens and Anterior Eye. The associated research fields include dermatology (a novel KRT10-related skin phenotype with vesicles and peeling) and ophthalmology (biomechanical protein differences in myopic corneas). The cited application is immunofluorescence in human samples.

SpeciesApplicationTitle

J Dermatol Sci

KRT10-nEDD-superficial: A novel phenotype characterized by vesicles and skin peeling.

Authors - Norito Ishii
humanIF

Cont Lens Anterior Eye

The biomechanical proteins different between low myopic corneas and moderate to high myopic corneas in human

Authors - Wenjing Wu
Loading...
||
New chat

Able™

正在加载,请稍候...