Product Information
87529-1-PBS targets NOP10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag18718 Product name: Recombinant human NOP10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC063023 Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL Predict reactive species |
| Full Name | NOP10 ribonucleoprotein homolog (yeast) |
| Calculated Molecular Weight | 64 aa, 77 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | BC063023 |
| Gene Symbol | NOP10 |
| Gene ID (NCBI) | 55505 |
| RRID | AB_3745601 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NPE3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Nucleolar protein 10 (NOP10) is a component of the H/ACA small nucleolar ribonucleoprotein (snoRNP) complex and is essential for maintaining telomerase activity and RNA pseudouridylation. NOP10 is abnormally expressed in a variety of cancers such as breast cancer, pancreatic cancer, lung cancer, etc., and high expression is usually associated with poor prognosis(PMID: 33161513; 39538226).





