TMEM204 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM204 Polyclonal antibody (20479-1-AP)

• 

  WB analysis using 20479-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20479-1-AP (TMEM204 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 20479-1-AP

  IP result of anti-TMEM204 (IP:20479-1-AP, 4ug; Detection:20479-1-AP 1:800) with mouse kidney tissue lysate 3400 ug.

• 

  IHC staining of mouse kidney using 20479-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20479-1-AP (TMEM204 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 20479-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 20479-1-AP (TMEM204 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM204 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 20479-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

C16orf30, Claudin like protein 24, CLP24, transmembrane protein 204

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse lung tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: mouse lung tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20479-1-AP targets TMEM204 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14353

  Product name: Recombinant human TMEM204 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-114 aa of BC004932

  Sequence: VSLILNNVAAFTSNWVCQTLEDGRRRSVGLWRSCWLVDRTRGGPSPGARAGQVDAHDCEALGWGSEAAGFQESRGTVKLQFDMMRACNLVATAALTAGQ

• Full Name: transmembrane protein 204
• Calculated Molecular Weight: 226 aa, 25 kDa
• Observed Molecular Weight: 24-30 kDa
• GenBank Accession Number: BC004932
• Gene Symbol: TMEM204
• Gene ID (NCBI): 79652
• RRID: AB_3741997
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSN7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.