Filter:
Tested Applications
| Positive WB detected in | A2780 cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
33935-1-AP targets DBX1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag40954 Product name: Recombinant human DBX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 241-343 aa of NM_001029865 Sequence: ERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS Predict reactive species |
| Full Name | developing brain homeobox 1 |
| Calculated Molecular Weight | 343aa, 37 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | NM_001029865 |
| Gene Symbol | DBX1 |
| Gene ID (NCBI) | 120237 |
| RRID | AB_3743117 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | A6NMT0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DBX1 (Homeobox protein DBX1) is a central nervous system (CNS)-specific transcription factor that plays crucial roles in embryonic brain development. It belongs to the H2.0 homeobox family and contains a DNA-binding homeodomain, which allows it to regulate gene expression by binding to specific DNA sequences.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for DBX1 antibody 33935-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
