Use Able AI chat for product recommendations

GPNMB Monoclonal antibody

GPNMB Monoclonal Antibody for ELISA

Cat No. 66926-1-Ig
Clone No. 2B10B8
Publications (29)
Reviews (2)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF, ELISA

2B10B8, Hematopoietic growth factor inducible neurokinin-1 type, NMB, Osteoactivin, Transmembrane glycoprotein NMB

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for GPNMB in ?

Product Information

66926-1-Ig targets GPNMB in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26747

Product name: Recombinant human GPNMB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 38-158 aa of BC011595

Sequence: MREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPD

Predict reactive species
Full Name glycoprotein (transmembrane) nmb
Calculated Molecular Weight 64 kDa
GenBank Accession NumberBC011595
Gene Symbol GPNMB
Gene ID (NCBI) 10457
RRIDAB_2882253
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14956
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPNMB also known as HGFIN, osteoactivin, and DC-HIL, is a type I membrane glycoprotein involved in various biological processes, including inflammation, invasion and metastasis of malignant tumors, cell differentiation, and tissue regeneration. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB acts as an osteogenic factor that stimulates osteoblast differentiation in vivo and in vitro.

Protocols

Product Specific Protocols
WB protocol for GPNMB antibody 66926-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

66926-1-Ig is a GPNMB antibody with 29 total citations. It appears in high-impact journals including Nature, Immunity, Cancer Discovery, Nature Genetics, Nature Communications, Molecular Cell, and Genome Medicine. Research fields span neurodegenerative diseases (Alzheimer's, stroke), oncology (hepatocellular, renal cell, esophageal, breast, and lung cancers), immunology (macrophage/microglia biology, inflammasome signaling), fibrosis, cardiovascular disease, and reproductive endocrinology.

SpeciesApplicationTitle
mouseIF

Nature

Lithium deficiency and the onset of Alzheimer's disease.

Authors - Liviu Aron
humanIF

Immunity

Direct microglia replacement reveals pathologic and therapeutic contributions of brain macrophages to a monogenic neurological disease

Authors - William H Aisenberg

Cancer Discov

A Circulating GPNMB-Based Multimodal Model Integrates Tumor-Immune Crosstalk to Predict Immunotherapy Response in Esophageal Cancer.

Authors - Liang Zhu

Nat Genet

Plasticity of human microglia and brain perivascular macrophages in aging and Alzheimer's disease.

Authors - Donghoon Lee
mouseIHC

Nat Commun

Ultra-precision deconvolution of spatial transcriptomics decodes immune heterogeneity and fate-defining programs in tissues.

Authors - Yin Xu
humanWB

Mol Cell

A TBK1-independent primordial function of STING in lysosomal biogenesis

Authors - Bo Lv

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers gave this GPNMB antibody a perfect 5-star rating. One user reported excellent Western Blot performance on cerebellum tissue at a 1:5000 dilution. The other praised its use for immunofluorescence and Western Blot on macrophages at the recommended 1:500 concentration, noting highly specific staining with minimal background noise and a very clear, distinct signal. Overall, customers find this antibody reliable, specific, and easy to use across multiple applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Pravin (Verified Customer) (04-03-2026)

Antiboy works well at this dilution.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Cerebellum Tissue

Victor (Verified Customer) (06-16-2025)

Staining with the GPNMB antibody on myeloid cells using the recommended concentration for immunofluorescence is highly specific. The signal shows minimal background noise and appears very clear and distinct.

  • Applications: Western Blot, Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:500 as recommended
  • Cell Tissue Type: Macrophages
GPNMB Antibody Western Blot,Immunofluorescence,Cell culture validation (1:500 as recommended dilution) in Macrophages (Cat no:66926-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...