Integrin alpha-9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Integrin alpha-9 Polyclonal antibody (28348-1-AP)

Integrin alpha-9 Polyclonal Antibody for WB, ELISA

Cat No. 28348-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ITGA9, ALPHA RLC, Integrin alpha 9, Integrin alpha RLC, Integrin alpha-RLC

• 

  WB analysis using 28348-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28348-1-AP (Integrin alpha 9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28348-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28348-1-AP (Integrin alpha-9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A-673 cells, HeLa cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

28348-1-AP targets Integrin alpha-9 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28815

  Product name: Recombinant human Integrin alpha-9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 462-613 aa of BC030198

  Sequence: VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPEEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQ

• Full Name: integrin, alpha 9
• Calculated Molecular Weight: 114 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC030198
• Gene Symbol: Integrin alpha 9
• Gene ID (NCBI): 3680
• RRID: AB_3669655
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13797
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). Integrin alpha 9 contains a large N-terminal extracellular domain with 7 conserved repeats of putative metal-binding domains, a transmembrane segment, and a short C-terminal cytoplasmic tail (PMID: 8245132). Integrin alpha 9 interacts with integrin beta 1, generating α9β1 heterodimer, which is expressed in many cell types, including epithelial cells, neutrophils, hepatocytes, muscle, and endothelial cells (PMID: 21975548). It binds to a diversity of ligands in the extracellular matrix, like the a-disintegrin and metalloprotease (ADAM) family, THBS1, EMILIN1, VEGF, tenascin-C, osteopontin, fibronectin, and VCAM1 (PMID: 21975548; 33790909). Integrin α9β1 has been implicated in diverse biological functions, including angiogenesis, lymphangiogenesis, lymphatic valve morphogenesis, granulopoiesis and tumorigenesis (PMID: 20179422).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC	Mater Today Bio; Hepatic cavernous hemangioma decellularized extracellular matrix/GelMA composite hydrogel promotes angiogenesis via the ITGA9-FAK-ERK1/2 axis.; Authors - Zongbo Dai ; KD Validated