AP5Z1/SPG48 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AP5Z1/SPG48 Polyclonal antibody (34075-1-AP)

• 

  WB analysis using 34075-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34075-1-AP (AP5Z1/SPG48 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 34075-1-AP

  IP result of anti-AP5Z1/SPG48 (IP:34075-1-AP, 4ug; Detection:34075-1-AP 1:800) with HeLa cells lysate 1200 ug.

AP5Z1/SPG48 Polyclonal Antibody for WB, IP, ELISA

Cat No. 34075-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

KIAA0415, Adaptor-related protein complex 5 zeta subunit, AP-5 complex subunit zeta-1, AP5Z1, SPG48

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, MG-63 cells, U2OS cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34075-1-AP targets AP5Z1/SPG48 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26954

  Product name: Recombinant human KIAA0415 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 260-364 aa of BC037399

  Sequence: TLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASV

• Full Name: KIAA0415
• Calculated Molecular Weight: 807 aa, 88 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC037399
• Gene Symbol: AP5Z1/SPG48
• Gene ID (NCBI): 9907
• RRID: AB_3743150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O43299
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP5Z1, also known as SPG48 and KIAA0415, is a part of AP-5. Biallelic mutations in the AP5Z1 gene encoding the AP5Z1 subunit have been described in a small number of patients with hereditary spastic paraplegia (HSP). AP5Z1 physically interacts with other HSP proteins and that patient cells are sensitive to DNA damaging drugs.