NCX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NCX1 Polyclonal antibody (28447-1-AP)

NCX1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28447-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Na(+)/Ca(2+)-exchange protein 1, NCX 1, NCX-1, SLC8A1, Solute carrier family 8 member 1

• 

  WB analysis using 28447-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28447-1-AP (NCX1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 28447-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28447-1-AP (NCX1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 28447-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28447-1-AP (NCX1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 28447-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28447-1-AP (NCX1 antibody) at dilution of 1:1600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NCX1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue, rat kidney tissue, mouse kidney tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28447-1-AP targets NCX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28952

  Product name: Recombinant human SLC8A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of NM_021097

  Sequence: MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGV

• Full Name: solute carrier family 8 (sodium/calcium exchanger), member 1
• Calculated Molecular Weight: 109 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_021097
• Gene Symbol: NCX1
• Gene ID (NCBI): 6546
• RRID: AB_2918167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32418
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC8A1, also known as NCX1, belongs to the SLC (Solute Carrier) family and the CaCA (Calcium/Cation Antiporter) superfamily. NCX1 is a bidirectional ion exchanger that can exchange sodium and calcium ions between the inside and outside of cells in a 1:3 ratio (1 Ca2+ ion and 3 Na+ ions). Under physiological conditions, NCX1 mainly transports Ca2+ from the cell interior to the exterior through the forward transport mode to maintain the low calcium level inside the cell. However, under certain special conditions, such as ischemia-reperfusion injury and stroke, the reverse transport mode of NCX1 is activated, leading to the influx of Ca2+ into the cell, which may cause cell damage (PMID: 21289289, 30686898).

Publications

What published studies show

NCX1 Polyclonal antibody (Cat# 28447-1-AP) has been cited in 12 publications across journals including Signal Transduction and Targeted Therapy, Journal of Neuroinflammation, Phytomedicine, Acta Pharmacologica Sinica, Cell Reports, Biochemical Pharmacology, and The American Journal of Physiology. Associated research fields include cardiac and cardiometabolic diseases (HFpEF, hypertrophic cardiomyopathy, atrial fibrillation), calcium signaling and homeostasis, neuroinflammation and neurodegeneration, multiple myeloma, and tendinopathy.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Signal Transduct Target Ther; Visinin-like protein 1 disrupts calcium homeostasis and promotes atrial fibrillation in human and rodent models; Authors - Ke Xiong
mouse	WB	J Neuroinflammation; Sexually dimorphic extracellular vesicle responses after chronic spinal cord injury are associated with neuroinflammation and neurodegeneration in the aged brain; Authors - Yun Li
		Phytomedicine; Cinobufagin overcomes bortezomib resistance in multiple myeloma strains by targeting SEC62/TRPM4-mediated NECSO; Authors - Zhao Yin
mouse	WB	Acta Pharmacol Sin; Porcupine inhibitor CGX1321 alleviates heart failure with preserved ejection fraction in mice by blocking WNT signaling; Authors - Hao Wu
human	WB	Cell Rep; Mitochondrial transplantation rescues Ca2+ homeostasis imbalance and myocardial hypertrophy in SLC25A3-related hypertrophic cardiomyopathy; Authors - Shuang Li
rat	WB	Biochem Pharmacol; Aquaporin-1 (AQP1) mediates cardiac oedema and mitochondrial dysfunction in cardiometabolic HFpEF: New insights into the mechanisms of SGLT2 inhibitors.; Authors - Shilin Guan