Tested Applications
| Positive WB detected in | human brain tissue, A549 cells, rat brain tissue |
| Positive IP detected in | rat brain tissue |
| Positive IHC detected in | mouse brain tissue, human gliomas tissue, human lung cancer tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10214-1-Ig targets TSC22D1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0287 Product name: Recombinant human TSC22D1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-144 aa of BC000456 Sequence: KSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA Predict reactive species |
| Full Name | TSC22 domain family, member 1 |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC000456 |
| Gene Symbol | TSC22D1 |
| Gene ID (NCBI) | 8848 |
| RRID | AB_2272193 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15714 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TSC22 domain family 1, transforming growth factor beta 1 induced transcript 4, (TSC22D1, synonyms: TSC22, TGFB1I4, MGC17597) is a member of a family of leucine zipper containing transcription factors with repressor activity and belongs to the large family of early response genes. TSC-22 regulates cell growth and differentiation, and cell death. Leucine zipper structure of TSC22 inhibits the anchorage independent growth of cancer cells. TSC-22 is also an important downstream component of peroxisome proliferator-activated receptor (PPAR) and TGF-beta signaling during intestinal epithelial cell differentiation. This antibody is a rabbit polyclonal antibody raised against an internal region of human TSC22D1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TSC22D1 antibody 10214-1-Ig | Download protocol |
| IHC protocol for TSC22D1 antibody 10214-1-Ig | Download protocol |
| IP protocol for TSC22D1 antibody 10214-1-Ig | Download protocol |
| WB protocol for TSC22D1 antibody 10214-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Anti-TSC22D1 antibody (Cat# 10214-1-Ig) has 10 citations spanning journals including Cell Death & Differentiation, Clinical Cancer Research, Cell Death & Discovery, FEBS Journal, Cell Reports, International Journal of Molecular Sciences, Molecular and Cellular Biochemistry, Journal of Cellular Physiology, American Journal of Physiology, and Biochemical and Biophysical Research Communications. Research fields cover cancer biology (prostate, cervical, colorectal, medulloblastoma), TGF-β signaling, apoptosis, cell-cycle regulation, protein interactions, vascular biology, and cell volume homeostasis.
| Species | Application | Title |
|---|---|---|
Cell Death Differ TSC-22D1 isoforms have opposing roles in mammary epithelial cell survival. | ||
Clin Cancer Res Transforming Growth Factor-{beta}-Stimulated Clone-22 Is an Androgen-Regulated Gene That Enhances Apoptosis in Prostate Cancer following Insulin-Like Growth Factor-I Receptor Inhibition.
| ||
Cell Death Discov RNA-binding protein MEX3D promotes cervical carcinoma tumorigenesis by destabilizing TSC22D1 mRNA.
| ||
Int J Mol Sci Identification of Binding Proteins for TSC22D1 Family Proteins Using Mass Spectrometry. | ||
Mol Cell Biochem Regulation of TGF-β signaling by PKC depends on Tsc-22 inducibility.
| ||
FEBS J Multiple TSC22D4 iso-/phospho-glycoforms display idiosyncratic subcellular localizations and interacting protein partners. |
