Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, L02 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10261-1-AP targets PRPF18 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0329 Product name: Recombinant human PRPF18 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-47 aa of BC002572 Sequence: MDILKSEILRKRQLVEDRNLLREYVKANDAYLQMAIGNAPWPIGVTM Predict reactive species |
| Full Name | PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 5 aa, 475 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC002572 |
| Gene Symbol | PRPF18 |
| Gene ID (NCBI) | 8559 |
| RRID | AB_3741814 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99633 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRPF18 encodes a spliceosomal factor that is essential for the catalytic step II of pre-mRNA splicing. It functions in the spliceosome during RNA processing and shows sequence similarity to the yeast splicing factor Prp18. The protein contains WD repeats, a feature consistent with protein-protein interactions, and belongs to the PRP18 family and the spliceosomal C complex.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PRPF18 antibody 10261-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PRPF18 Polyclonal antibody (Cat# 10261-1-AP) has 1 total citation. It appears in Journal of Pharmaceutical Analysis (Impact Factor 11.2), published in 2025. The cited study investigates naringenin's role in boosting Parkin-mediated mitophagy via estrogen receptor alpha to maintain mitochondrial quality control in diabetic foot ulcer healing, placing this citation in the fields of mitochondrial biology, RNA splicing, and diabetic wound repair.
| Species | Application | Title |
|---|---|---|
J Pharm Anal Naringenin boosts Parkin-mediated mitophagy via estrogen receptor alpha to maintain mitochondrial quality control and heal diabetic foot ulcer. |
