Tested Applications
| Positive WB detected in | HK-2 cells, HEK-293 cells, HeLa cells, HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10477-1-AP targets CHMP2A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0719 Product name: Recombinant human CHMP2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC002502 Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLR Predict reactive species |
| Full Name | chromatin modifying protein 2A |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC002502 |
| Gene Symbol | CHMP2A |
| Gene ID (NCBI) | 27243 |
| RRID | AB_2079470 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43633 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHMP2A, also known as Vps2-1, belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. CHMP2A is a component of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in the degradation of surface receptor proteins and the formation of endocytic multivesicular bodies (MVBs). It has been shown that CHMP2A can interact with and regulate the function of the AAA-ATPase VPS4B (PMID: 15173323). CHMP2A is also reported to be involved in HIV budding (PMID: 21396898; 23051622).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CHMP2A antibody 10477-1-AP | Download protocol |
| WB protocol for CHMP2A antibody 10477-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CHMP2A antibody (Cat# 10477-1-AP) has 73 citations in journals including Nature, Science, Cell, Nature Cell Biology, Nature Communications, Molecular Cell, Autophagy, EMBO Journal, Developmental Cell, Cell Reports, Current Biology, PNAS, and more. Associated research fields include ESCRT-III-mediated nuclear envelope reformation, autophagosome formation and closure, lysosomal membrane repair, cytokinetic abscission, neurodegeneration, cancer immunology, and viral infection.
| Species | Application | Title |
|---|---|---|
Nature Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
| ||
Science A p62-dependent rheostat dictates micronuclei catastrophe and chromosome rearrangements | ||
Cell Mammalian hybrid pre-autophagosomal structure HyPAS generates autophagosomes
|
Reviews
What customers say
Across five reviews, this CHMP2A antibody is well received, primarily for Western blot. Users report a clear band at the expected ~34 kDa with low background, especially after optimization. Typical dilutions range from 1:500 to 1:1000. A couple of reviewers noted the presence of nonspecific bands, which slightly lowered their ratings. One immunofluorescence review highlighted clean staining in methanol-fixed HeLa cells at 1:300. Overall, the antibody is considered reliable and effective for its intended applications, with minor issues around specificity in some cell lines.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jelan (Verified Customer) (01-14-2026) | When used in Western blotting, the CHMP2A antibody from Proteintech typically yields a clear band at the expected molecular weight with low background after optimization.
|
Haley (Verified Customer) (10-13-2025) | Works well for Western blot.
|
Matteo (Verified Customer) (01-09-2025) | The antibody performs well, showing a strong band at around 34 kDa, but it also detects several nonspecific bands
 |
Celine (Verified Customer) (12-20-2024) | works well, but an unspecific band
 |
Stephen (Verified Customer) (04-08-2019) | IF image of Methanol fixed a dividing HeLa cell Stained with CHMP2A antibody (green) and Tubulin Antibody (red)
 |
