Use Able AI chat for product recommendations

MPZ / P0 Polyclonal antibody

MPZ / P0 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

MPZ, Myelin protein zero, CHM, MPP, Myelin peripheral protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MPZ / P0 in ?

Tested Applications

Positive WB detected inmouse brain tissue, mouse skeletal muscle tissue, rat brain tissue
Positive IHC detected inmouse Ischiadic nerve tissue, rat Ischiadic nerve tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10572-1-AP targets MPZ / P0 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, frog
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0848

Product name: Recombinant human MPZ,P0 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-258 aa of BC006491

Sequence: MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK

Predict reactive species
Full Name myelin protein zero
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28-30 kDa
GenBank Accession NumberBC006491
Gene Symbol MPZ
Gene ID (NCBI) 4359
RRIDAB_2144657
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25189
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MPZ (myelin protein zero), also known as P0, is a transmembrane glycoprotein that belongs to the immunoglobulin supergene family. Synthesized by myelin-forming Schwann cells, MPZ is the major structural protein component of myelin in the peripheral nervous system. It is involved in the formation and maintenance of compact myelin and plays a role in the creation of an extracellular membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. More than 120 mutations detected in the gene of MPZ cause various forms of hereditary neuropathy, which include Charcot-Marie-Tooth disease type 1B (CMT1B), CMT2, Dejerine-Sottas syndrome (DSS), and congenital hypomyelination neuropathy (CHN). This antibody can recognize endogenous MPZ and can be used as a marker of myelinating Schwann cells. MPZ can be detected the 25-30 kDa band by western blot. A band of 36 kDa could also be detected, which is a novel isoform of MPZ that contains an additional domain at the C-terminal (PMID: 22457349). It can also exist as a dimer (PMID: 12933931).

Protocols

Product Specific Protocols
IHC protocol for MPZ / P0 antibody 10572-1-APDownload protocol
WB protocol for MPZ / P0 antibody 10572-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-P0 antibody (Cat# 10572-1-AP) has accumulated 24 citations across journals including Nature Communications, Bioactive Materials, Glia, Aging Cell, Journal of Neuroscience, Neurotherapeutics, Phytomedicine, and Molecular Biology of the Cell. Research fields span peripheral nerve regeneration, Schwann cell biology, myelination, diabetic neuropathy, Charcot-Marie-Tooth disease, and spinal cord injury. Applications include WB, IF, CoIP, and IHC across human, rat, mouse, and other species.

SpeciesApplicationTitle
IF

Bioact Mater

Dental pulp stem cells alleviate Schwann cell pyroptosis via mitochondrial transfer to enhance facial nerve regeneration

Authors - Xiaoyu Zheng
mouse,humanIF

Nat Commun

Single-cell analysis reveals region-heterogeneous responses in rhesus monkey spinal cord with complete injury

Authors - Yongheng Fan
WB,IF

Nat Commun

Brown adipose tissue secretes OLFM4 to coordinate sensory and sympathetic innervation via Schwann cells

Authors - Mingqiang Lai

J Nanobiotechnology

Electrical aligned polyurethane nerve guidance conduit modulates macrophage polarization and facilitates immunoregulatory peripheral nerve regeneration

Authors - Yiting Sun
ratWB

Phytomedicine

Huangqi Guizhi Wuwu decoction alleviate Oxaliplatin-Induced Peripheral Neuropathy by adjusting the myelin regeneration

Authors - Xueying Yang
ratWB,IF

Phytother Res

Jatrorrhizine ameliorates Schwann cell myelination via inhibiting HDAC3 ability to recruit Atxn2l for regulating the NRG1-ErbB2-PI3K-AKT pathway in diabetic peripheral neuropathy mice

Authors - Xiaobao Gong
Loading...
||
New chat

Able™

正在加载,请稍候...