• Featured Product
  • KD/KO Validated

TIMM17B Polyclonal antibody

TIMM17B Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 11062-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

DXS9822, JM3, Mitochondrial import inner membrane translocase subunit Tim17-B, TIM17B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, mouse liver tissue, PC-3 cells
Positive IP detected inPC-3 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11062-1-AP targets TIMM17B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1504

Product name: Recombinant human TIMM17B protein

Source: e coli.-derived, PKG

Tag: GST

Domain: 1-172 aa of BC010142

Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

Predict reactive species
Full Name translocase of inner mitochondrial membrane 17 homolog B (yeast)
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 17-20 kDa
GenBank Accession NumberBC010142
Gene Symbol TIMM17B
Gene ID (NCBI) 10245
RRIDAB_2201995
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60830
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for TIMM17B antibody 11062-1-APDownload protocol
IP protocol for TIMM17B antibody 11062-1-APDownload protocol
WB protocol for TIMM17B antibody 11062-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Metab

Acylglycerol Kinase Maintains Metabolic State and Immune Responses of CD8+ T Cells.

Authors - Zhilin Hu
humanWB

Mol Cell

Acylglycerol Kinase Mutated in Sengers Syndrome Is a Subunit of the TIM22 Protein Translocase in Mitochondria.

Authors - Milena Vukotic
humanWB

Mol Cell

Sengers Syndrome-Associated Mitochondrial Acylglycerol Kinase Is a Subunit of the Human TIM22 Protein Import Complex.

Authors - Yilin Kang
human

Cell Rep

TIM23 facilitates PINK1 activation by safeguarding against OMA1-mediated degradation in damaged mitochondria

Authors - Shiori Akabane

Sci Rep

The presence of disulfide bonds reveals an evolutionarily conserved mechanism involved in mitochondrial protein translocase assembly.

Authors - Lidia Wrobel
humanWB

Infect Immun

The type III system-secreted effector EspZ localizes to host mitochondria and interacts with the translocase of inner mitochondrial membrane 17b.

Authors - Shames Stephanie R SR

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Angela (Verified Customer) (12-27-2024)

good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: heart tissue
TIMM17B Antibody Western Blot validation (1:1000 dilution) in heart tissue (Cat no:11062-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...