Tested Applications
| Positive WB detected in | HCT 116 cells, HepG2 cells, mouse skeletal muscle tissue, HeLa cells, mouse spleen tissue, SW480 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11114-1-AP targets TAP1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1619 Product name: Recombinant human TAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 509-808 aa of BC014081 Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE Predict reactive species |
| Full Name | transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) |
| Calculated Molecular Weight | 81 kDa |
| Observed Molecular Weight | 70-81 kDa |
| GenBank Accession Number | BC014081 |
| Gene Symbol | TAP1 |
| Gene ID (NCBI) | 6890 |
| RRID | AB_2200201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03518 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatibility complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70-80 kDa in HeLa cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TAP1 antibody 11114-1-AP | Download protocol |
| IHC protocol for TAP1 antibody 11114-1-AP | Download protocol |
| IP protocol for TAP1 antibody 11114-1-AP | Download protocol |
| WB protocol for TAP1 antibody 11114-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TAP1 Polyclonal antibody (Cat# 11114-1-AP) has 44 citations. These appear in high-impact journals including Nature, Cell, Gastroenterology, Nature Communications, Theranostics, J Immunother Cancer, PNAS, Diabetes, Cell Reports, JCI Insight, J Immunol, J Biol Chem, BMC Cancer, and Frontiers in Oncology. Research fields span immunology and antigen presentation (MHC-I/HLA class I), cancer biology and immunotherapy, viral pathogenesis, diabetes, and proteomics, with applications mainly in WB, IHC, IF, IP, and CoIP.
| Species | Application | Title |
|---|---|---|
Cell Systematic discovery of pathogen effector functions across human pathogens and pathways. | ||
Gastroenterology microRNA 125a Regulates MHC-I Expression on Esophageal Adenocarcinoma Cells, Associated With Suppression of Antitumor Immune Response and Poor Outcomes of Patients. | ||
Drug Resist Updat RNF26 regulating tumor immunogenicity of hepatocellular carcinoma by degrading GRP78 and instigating ER stress. | ||
Nat Commun Proteomic analysis of archival breast cancer clinical specimens identifies biological subtypes with distinct survival outcomes. | ||
Theranostics Nintedanib enhances the efficacy of PD-L1 blockade by upregulating MHC-I and PD-L1 expression in tumor cells. |
Reviews
What customers say
The single review for this antibody is highly positive (5/5). The user tested it on MCF7 cells by Western Blot at a 1:1000 dilution and found it excellent. They noted that, unlike anti-TAP1 antibodies from other companies—which showed brighter contaminant bands than the target—this antibody clearly detected the protein of interest with clean, specific results. Overall, reviewers praise its specificity and ability to produce clear, reliable bands.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Adrianna (Verified Customer) (10-24-2022) | This antibody is excellent. I've tried anti TAP1 antibodies from different companies and they all showed brighter bands for contaminants than the TAP1 protein, here I can clearly see my protein of interest.
|
