Tested Applications
| Positive WB detected in | human liver tissue, A549 cells |
| Positive IHC detected in | human ovary tumor tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11218-1-AP targets TCEAL7 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1715 Product name: Recombinant human TCEAL7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC016786 Sequence: MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI Predict reactive species |
| Full Name | transcription elongation factor A (SII)-like 7 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC016786 |
| Gene Symbol | TCEAL7 |
| Gene ID (NCBI) | 56849 |
| RRID | AB_2201131 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BRU2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TCEAL7 is a transcription regulatory factor that has a role in the negative regulation of NF-kappa-B signaling at the basal level by regulating transcriptional activity of NF-kappa-B on its target gene promoters. It can associate with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. In addition, TCEAL7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TCEAL7 antibody 11218-1-AP | Download protocol |
| WB protocol for TCEAL7 antibody 11218-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TCEAL7 Polyclonal antibody (Cat# 11218-1-AP) has 2 total citations. These appear in Cancer Cell International and PLoS One. The cited research focuses on cancer biology, specifically melanoma progression involving c-Myc/AKT1 regulation and gastric adenocarcinoma prognosis, with applications in Western blotting and immunohistochemistry on human samples.
| Species | Application | Title |
|---|---|---|
Cancer Cell Int Transcription elongation factor A-like 7, regulated by miR-758-3p inhibits the progression of melanoma through decreasing the expression levels of c-Myc and AKT1.
| ||
PLoS One Decreased expression of transcription elongation factor A-like 7 is associated with gastric adenocarcinoma prognosis. |







