Tested Applications
| Positive WB detected in | HEK-293 cells, HSC-T6 cells, HeLa cells, Jurkat cells, L02 cells, PC-12 cells |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11251-1-AP targets SUMO2/3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1778 Product name: Recombinant human SUMO2/3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC016775 Sequence: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY Predict reactive species |
| Full Name | SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11-20 kDa |
| GenBank Accession Number | BC016775 |
| Gene Symbol | SUMO2 |
| Gene ID (NCBI) | 6613 |
| RRID | AB_2198405 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61956 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SUMO2/3 antibody 11251-1-AP | Download protocol |
| IHC protocol for SUMO2/3 antibody 11251-1-AP | Download protocol |
| WB protocol for SUMO2/3 antibody 11251-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SUMO2/3 Polyclonal antibody (catalog no. 11251-1-AP) has 41 citations. These appear in journals including Signal Transduction and Targeted Therapy, Cancer Research, Nature Communications, Cell Discovery, Theranostics, Advanced Science, Science Advances, Cell Death & Differentiation, Cell Reports, Molecular Psychiatry, mBio, iScience, and eLife. Research fields span oncology (glioblastoma, colon, prostate, bladder, gastric, liver, endometrial, lung cancers), ferroptosis, DNA damage repair, neurodegeneration (Alzheimer's), inflammation, viral infection, and post-translational SUMOylation mechanisms.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther NUSAP1 potentiates chemoresistance in glioblastoma through its SAP domain to stabilize ATR.
| ||
Cancer Res SENP1 decreases RNF168 phase separation to promote DNA damage repair and drug resistance in colon cancer | ||
Nat Commun YY1 enhances HIF-1α stability in tumor-associated macrophages to suppress anti-tumor immunity of prostate cancer in mice | ||
Cell Discov Ferroptosis-induced SUMO2 lactylation counteracts ferroptosis by enhancing ACSL4 degradation in lung adenocarcinoma. | ||
Theranostics SUMOylation of SARS-CoV-2 spike protein is a key target for broad-spectrum antiviral therapy
| ||
Theranostics Chlorogenic acid effectively treats cancers through induction of cancer cell differentiation. |
Reviews
What customers say
Both reviews are for Western Blot applications using lot 00011665. One reviewer (4/5) tested the antibody on a lymphoblastic cell line at 1:1000 dilution, reporting good bands with minor aspecificity, which they attributed to the high-resolution gels and the nature of lymphoblastoid cells. They concluded it is a good antibody. The second reviewer (5/5) tested it on AC16 cells and simply rated it "Good." Overall, users report reliable performance in WB with clean, specific bands.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Verdiana (Verified Customer) (03-02-2023) | Good bands. Little aspecific I think but the gels we use have a high resolution and also those were lympoblastoid cells and we know they can me strange. Anyway, it is a good antibody.
 |
Shubham (Verified Customer) (03-13-2019) | Good
 |
