Tested Applications
| Positive WB detected in | mouse brain tissue, MCF-7 cells, rat brain tissue |
| Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11417-2-AP targets COX7B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1988 Product name: Recombinant human COX7B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC018386 Sequence: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIIb |
| Calculated Molecular Weight | 80 aa, 9 kDa |
| Observed Molecular Weight | 9 kDa |
| GenBank Accession Number | BC018386 |
| Gene Symbol | COX7B |
| Gene ID (NCBI) | 1349 |
| RRID | AB_2085709 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24311 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX7B, also named as Cytochrome c oxidase subunit 7B, mitochondrial, is a 80 amino acid protein, which belongs to the cytochrome c oxidase VIIb family. COX7B protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX7B plays a role in proper central nervous system development in vertebrates. COX7B as a terminal enzyme in the mitochondrial respiratory chain (oxidative phosphorylation OXPHOS), catalyzing the electron transfer from reduced cytochrome c to molecule oxygen and plays a role in eye development.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX7B antibody 11417-2-AP | Download protocol |
| WB protocol for COX7B antibody 11417-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COX7B Polyclonal antibody (catalog #11417-2-AP) has 6 citations. These appear in Cell Stem Cell, Pharmacological Research, Biomolecules, Journal of Nutritional Biochemistry, Journal of Biological Chemistry, and Archives of Biochemistry and Biophysics. The associated research fields include mitochondrial metabolism and dysfunction, cancer (AML, gastric, glioma, esophageal), chemoresistance, oxidative stress, autophagy-apoptosis crosstalk, and signaling pathways. Most studies applied the antibody for Western blot in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Selective translation of nuclear mitochondrial respiratory proteins reprograms succinate metabolism in AML development and chemoresistance | ||
Pharmacol Res Discovery of KMT5A repressed miR-99b cluster with potential to restore chemotherapy sensitivity in gastric cancer by regulating mitochondrial complex II and affecting OXPHOS. | ||
Biomolecules Association of F-53B Nephrotoxicity with Oxidative Stress-Mediated Mitochondrial Dysfunction and Altered Autophagy-Apoptosis Crosstalk. | ||
J Nutr Biochem Deficiency of β-carotene oxygenase 2 induces mitochondrial fragmentation and activates the STING-IRF3 pathway in the mouse hypothalamus. | ||
Arch Biochem Biophys Knockdown of ABCB7 inhibits esophageal cancer progression by inhibiting the TGF-β/Smad signaling |
