Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

HOPX Polyclonal antibody

HOPX Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11419-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

HOD, CAMEO, Homeodomain only protein, Homeodomain-only protein, HOP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse lung tissue, mouse small intestine tissue, rat lung tissue
Positive IHC detected inhuman placenta tissue, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11419-1-AP targets HOPX in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1979

Product name: Recombinant human HOPX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-73 aa of BC014225

Sequence: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID

Predict reactive species
Full Name HOP homeobox
Calculated Molecular Weight 73 aa, 8 kDa
Observed Molecular Weight 8-12 kDa
GenBank Accession NumberBC014225
Gene Symbol HOPX
Gene ID (NCBI) 84525
RRIDAB_10693525
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BPY8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HOPX (Homeodomain-only protein) gene has various synonyms including HOD, HOP, OB1, LAGY and NECC1. The protein encoded by this gene is an unusual homeodomain protein that lacks certain conserved residues required for DNA binding. HOPX has diverse effects on cardiac growth. Manipulation of Hopx function in murine models is associated with cardiac hypertrophy, dilation and fibrosis. HOPX protein acts as an antagonist to the serum response factor (SRF), which regulates the opposing processes of cell proliferation and differentiation. Overexpression of HOPX causes cardiac hypertrophy. HOPX protein can inhibit SRF-dependent transcriptional activation by recruiting histone deacetylase (HDAC) activity.

Protocols

Product Specific Protocols
IHC protocol for HOPX antibody 11419-1-APDownload protocol
WB protocol for HOPX antibody 11419-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIHC

Nature

Cell stress in cortical organoids impairs molecular subtype specification.

Authors - Aparna Bhaduri
humanIF

Cell

Origins and Proliferative States of Human Oligodendrocyte Precursor Cells.

Authors - Wei Huang
humanIHC

Cancer Cell

Epigenomic State Transitions Characterize Tumor Progression in Mouse Lung Adenocarcinoma.

Authors - Lindsay M LaFave
human

Cancer Cell

Control of alveolar differentiation by the lineage transcription factors GATA6 and HOPX inhibits lung adenocarcinoma metastasis.

Authors - William K C Cheung
humanIF

Cell Stem Cell

LIF signaling regulates outer radial glial to interneuron fate during human cortical development

Authors - Madeline G Andrews
mouseIF

Protein Cell

BMP7 expression in mammalian cortical radial glial cells increases the length of the neurogenic period

Authors - Zhenmeiyu Li

Reviews

    4.7 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Bénédicte (Verified Customer) (02-13-2026)

IHC staining of mouse colon after induction of colitis using 11419-1-AP Immunohistochemical analysis of paraffin-embedded mouse colon tissue (mouse subjected to colitis) using 11419-1-AP (HOPX antibody) at dilution of 1:200 (30x on NDPview). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: mouse colon after colitis induction
HOPX Antibody Immunohistochemistry validation (1/200 dilution) in mouse colon after colitis induction (Cat no:11419-1-AP)

Nada (Verified Customer) (12-13-2024)

Performs well for immunoblotting and flow cytometry (performed internal validation prior to using)

  • Applications: Western Blot, Flow Cytometry

Ana (Verified Customer) (11-10-2020)

We recently published with this paper: PubMed ID: 32819430 Images are within the manuscript.Protocol information: We used Citirc Acid Buffer Antigen Retrieval

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Human Brain (fetal), Paraffin Processed
HOPX Antibody Immunohistochemistry validation (1:250 dilution) in Human Brain (fetal), Paraffin Processed (Cat no:11419-1-AP)

Nicole (Verified Customer) (07-23-2019)

Used to mark stem cell cultures for differentiation into neural like cells

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Cell Tissue Type: Stem Cell culture
Loading...
||
New chat

Able

正在加载,请稍候...