Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue, human kidney tissue, human heart tissue, COLO 320 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue, human colon cancer tissue, mouse stomach tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11601-1-AP targets IGF2BP2 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2142 Product name: Recombinant human IGF2BP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-341 aa of BC021290 Sequence: MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIM Predict reactive species |
| Full Name | insulin-like growth factor 2 mRNA binding protein 2 |
| Calculated Molecular Weight | 65 kDa |
| Observed Molecular Weight | 55-65 kDa |
| GenBank Accession Number | BC021290 |
| Gene Symbol | IGF2BP2 |
| Gene ID (NCBI) | 10644 |
| RRID | AB_2122672 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6M1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Insulin-like growth factor 2 mRNA-binding protein 2(IGF2BP2), ia a member of a family of mRNA binding protein, which can bind to several mammalian cells' mRNAs. Thus it may involve in the regulation of translation of mRNA. IGF2BP2's polymorphisms is risk factor for developing type 2 diabetes. This antibody raise against part of N-terminus of human IGF2BP2. IGF2BP2 has some isoforms with the MW of 54-66 kDa. Some literature has reported that multiple bands can be detected (PMID: 22427968, 36322753, 23069990).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IGF2BP2 antibody 11601-1-AP | Download protocol |
| IHC protocol for IGF2BP2 antibody 11601-1-AP | Download protocol |
| IP protocol for IGF2BP2 antibody 11601-1-AP | Download protocol |
| WB protocol for IGF2BP2 antibody 11601-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IGF2BP2 Polyclonal antibody (catalog number 11601-1-AP) has 276 citations. These appear in high-impact journals including Cell, Molecular Cancer, Cancer Research, Nature Communications, Cell Death & Disease, Oncogene, and Cell Reports. The associated research fields are dominated by m6A RNA modification and epitranscriptomics, with extensive focus on cancer biology (tumorigenesis, metastasis, chemoresistance), as well as metabolism, neurology, inflammation, and fibrosis. Applications span WB, IHC, IF, RIP, and IP.
| Species | Application | Title |
|---|---|---|
J Hematol Oncol N6-methyladenosine reader IMP2 stabilizes the ZFAS1/OLA1 axis and activates the Warburg effect: implication in colorectal cancer.
| ||
Cell FOCAS: Transcriptome-wide screening of individual m(6)A sites functionally dissects epitranscriptomic control of gene expression in cancer. | ||
Cell Synonymous mutations promote tumorigenesis by disrupting m6A-dependent mRNA metabolism | ||
Mol Cancer M6A-Methylated circRAPGEF5 drives lung adenocarcinoma progression and metastasis via IGF2BP2/NUP160-mediated autophagy suppression
| ||
Mol Cancer m6A methylation reader IGF2BP2 activates endothelial cells to promote angiogenesis and metastasis of lung adenocarcinoma |
Reviews
What customers say
The single review for this product rates it 5 stars. The reviewer used it for Western Blot on Hek293 cells at a 1:1000 dilution and described the antibody as good quality and specific. Overall, the feedback is positive, highlighting reliable performance and specificity in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Parisa (Verified Customer) (06-13-2022) | good quality and specify.
|
