Tested Applications
| Positive WB detected in | HEK-293 cells, HCT 116 cells, mouse brain tissue, rat brain tissue, MCF-7 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11795-1-AP targets TPD52L2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2364 Product name: Recombinant human TPD52L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC006804 Sequence: MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLS Predict reactive species |
| Full Name | tumor protein D52-like 2 |
| Calculated Molecular Weight | 206 aa, 22 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC006804 |
| Gene Symbol | TPD52L2 |
| Gene ID (NCBI) | 7165 |
| RRID | AB_2207431 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43399 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tumor protein D52-like proteins (TPD52) are small coiled-coil motif bearing proteins that were first identified in breast carcinoma. Three human TPD52 members had been identified, named hD52 (TPD52), hD53 (TPD52L1), and hD54 (TPD52L2). The most important characteristic of the protein family is a highly conserved coiled-coil motif that is required for homo- and heteromeric interaction with other TPD52-like proteins. TPD52 and related proteins have been implicated in cell proliferation, apoptosis, and vesicle trafficking. TPD52L2 has five isoforms produced by alternative splicing, and its multiple sites have been identified to be phosphorylated. Interaction of TPD52L2 with MAL2, a novel member of the MAL proteolipid family, may be required for the role of TPD52L2 in vesicle transport.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TPD52L2 antibody 11795-1-AP | Download protocol |
| IHC protocol for TPD52L2 antibody 11795-1-AP | Download protocol |
| IP protocol for TPD52L2 antibody 11795-1-AP | Download protocol |
| WB protocol for TPD52L2 antibody 11795-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Carcinogenesis TPD52L2 impacts proliferation, invasiveness and apoptosis of glioblastoma cells via modulation of wnt/β-catenin/snail signaling.
| ||
Cell Biosci Tumor protein D52 is upregulated in oral squamous carcinoma cells under hypoxia in a hypoxia-inducible-factor-independent manner and is involved in cell death resistance. | ||
J Biol Chem Tumor protein D54 binds intracellular nanovesicles via an extended amphipathic region. | ||
Int J Oncol Opposite effects of tumor protein D (TPD) 52 and TPD54 on oral squamous cell carcinoma cells. | ||
Biomed Res Int Tumor Proteins D52 and D54 Have Opposite Effects on the Terminal Differentiation of Chondrocytes. | ||
Neoplasma Silencing of TPD52 inhibits proliferation, migration, invasion but induces apoptosis of pancreatic cancer cells by deactivating Akt pathway.
|
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jerome (Verified Customer) (01-05-2020) | Puncta in the cytoplasm
![]() |
















