Tested Applications
| Positive WB detected in | PC-3 cells, RAW 264.7 cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11872-1-AP targets TIM3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2459 Product name: Recombinant human HAVCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC020843 Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE Predict reactive species |
| Full Name | hepatitis A virus cellular receptor 2 |
| Calculated Molecular Weight | 301 aa, 33 kDa |
| Observed Molecular Weight | 50-70 kDa, 33 kDa |
| GenBank Accession Number | BC020843 |
| Gene Symbol | TIM3 |
| Gene ID (NCBI) | 84868 |
| RRID | AB_10734330 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TDQ0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIM3 antibody 11872-1-AP | Download protocol |
| IHC protocol for TIM3 antibody 11872-1-AP | Download protocol |
| WB protocol for TIM3 antibody 11872-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TIM-3 antibody (catalog no. 11872-1-AP) has 17 citations. These appear in journals including Redox Biology, Theranostics, Cancer Letters, International Journal of Oncology, Frontiers in Immunology, CNS Neuroscience & Therapeutics, Frontiers in Cell and Infection Microbiology, Scientific Reports, European Thyroid Journal, Cell Signaling, Frontiers in Molecular Neuroscience, Immunology and Inflammation Diseases, International Journal of Clinical and Experimental Pathology, Iranian Journal of Immunology, Molecular Biomedicine, and Journal of Nanobiotechnology. Research fields span oncology (colorectal, esophageal, breast, glioblastoma, gastric, thyroid, leukemia), immunology, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Redox Biol Deoxycholic acid impairs mitochondrial fitness and suppresses mitophagy through Parkin ubiquitination driving CD8(+) T cell Exhaustion in Colorectal Cancer. | ||
Theranostics MIF-expressing tumor cells mediate immunotherapeutic resistance in esophageal squamous cell carcinoma. | ||
Cancer Lett The development and potent antitumor efficacy of CD44/CD133 dual-targeting IL7Rα-armored CAR-T cells against glioblastoma | ||
Int J Oncol Discovery of the late autophagy inhibitor FZU‑0045‑053 and its anti‑breast cancer and immunomodulatory effects. | ||
Front Immunol Development and evaluation of a peptide-based radiotracer for targeting TIM-3 in preclinical models. |
Reviews
What customers say
The product received a 4-star rating from a researcher who used it for Western Blot on mouse tissue at a 1:1000 dilution. The reviewer reported that the antibody worked nicely, indicating satisfactory performance for their application. Overall, the limited feedback suggests reliable results in WB, though the small sample size makes broader conclusions difficult.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Qing (Verified Customer) (06-10-2022) | It work nicely
|
