Tested Applications
| Positive IHC detected in | human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11959-1-AP targets SPRR1B in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2563 Product name: Recombinant human SPRR1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC056240 Sequence: MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK Predict reactive species |
| Full Name | small proline-rich protein 1B (cornifin) |
| Calculated Molecular Weight | 89 aa, 10 kDa |
| GenBank Accession Number | BC056240 |
| Gene Symbol | SPRR1B |
| Gene ID (NCBI) | 6699 |
| RRID | AB_2877807 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22528 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
This protein functions as a component of the cross-linked envelope in squamous differentiating cells. It runs as a 15-kDa protein in unreducing SDS PAGE, whereas under reducing conditions it runs as 23 kDa one.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SPRR1B antibody 11959-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SPRR1B Polyclonal Antibody (Cat# 11959-1-AP) has 5 citations appearing in Cell Discovery, Advanced Science, Science Advances, Frontiers in Oncology, and Canadian Journal of Diabetes. Associated research fields include keratoconus pathogenesis, lung squamous cell carcinogenesis, psoriasis autoimmunity, bladder cancer progression, and diabetic wound healing.
| Species | Application | Title |
|---|---|---|
Cell Discov Single-cell atlas of keratoconus corneas revealed aberrant transcriptional signatures and implicated mechanical stretch as a trigger for keratoconus pathogenesis. | ||
Adv Sci (Weinh) Real-Time Evolutionary Landscape of the Bronchial Epithelium and Corresponding Dynamic Immune Cell Alterations in Lung Squamous Cell Carcinogenesis | ||
Sci Adv Transcobalamin 1 is a keratinocyte-derived autoantigen driving psoriasis through T helper 17 cell activation. | ||
Front Oncol Long Noncoding RNA HAGLROS Promotes the Malignant Progression of Bladder Cancer by Regulating the miR-330-5p/SPRR1B Axis. | ||
Can J Diabetes Advanced Glycation End Products delay diabetic wound healing by OSR2/SPRR1B signaling in keratinocyte's proliferation and differentiation. |
