Tested Applications
| Positive WB detected in | human brain tissue, HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:300-1:1500 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12304-1-AP targets TBCA in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2950 Product name: Recombinant human TBCA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC018210 Sequence: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA Predict reactive species |
| Full Name | tubulin folding cofactor A |
| Calculated Molecular Weight | 108 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC018210 |
| Gene Symbol | TBCA |
| Gene ID (NCBI) | 6902 |
| RRID | AB_2199402 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75347 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TBCA antibody 12304-1-AP | Download protocol |
| IP protocol for TBCA antibody 12304-1-AP | Download protocol |
| WB protocol for TBCA antibody 12304-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TBCA Polyclonal antibody (Cat# 12304-1-AP) has 4 total citations. These appear in International Journal of Cancer, Oncology Reports, Frontiers in Genetics, and Histochemistry and Cell Biology. The associated research fields include clear cell renal cell carcinoma progression and metastasis, colorectal cancer metastasis via endoplasmic reticulum stress, female infertility linked to a TUBB8 loss-of-function mutation, and spatio-temporal distribution of tubulin-binding cofactors in the mouse cochlea.
| Species | Application | Title |
|---|---|---|
Int J Cancer Tubulin cofactor a functions as a novel positive regulator of ccRCC progression, invasion and metastasis. | ||
Oncol Rep ERp29 counteracts the suppression of malignancy mediated by endoplasmic reticulum stress and promotes the metastasis of colorectal cancer. | ||
Front Genet Target-Sequencing of Female Infertility Pathogenic Gene Panel and a Novel TUBB8 Loss-of-Function Mutation. | ||
Histochem Cell Biol Spatio-temporal distribution of tubulin-binding cofactors and posttranslational modifications of tubulin in the cochlea of mice. |
