Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

BMP4 Polyclonal antibody

BMP4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

BMP 4, BMP-4, BMP2B, BMP-2B, Bone morphogenetic protein 2B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for BMP4 in ?

Tested Applications

Positive WB detected inmouse heart tissue, rat heart tissue
Positive IHC detected inhuman prostate hyperplasia tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12492-1-AP targets BMP4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3191

Product name: Recombinant human BMP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-408 aa of BC020546

Sequence: ASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEAISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Predict reactive species
Full Name bone morphogenetic protein 4
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC020546
Gene Symbol BMP4
Gene ID (NCBI) 652
RRIDAB_2063531
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP12644
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BMP4, also named as BMP2B and DVR4, belongs to the TGF-beta family. BMPs have been shown to promote astroglial differentiation both in vitro and in vivo. BMP4 have been shown to be components of serum and are thought to be responsible for this differentiation. BMP4 are expressed mainly in neurons, with minimal expression detected in astrocytes and oligodendrocytes.

Protocols

Product Specific Protocols
IF protocol for BMP4 antibody 12492-1-APDownload protocol
IHC protocol for BMP4 antibody 12492-1-APDownload protocol
WB protocol for BMP4 antibody 12492-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BMP4 Polyclonal antibody (Cat# 12492-1-AP) has accumulated 35 citations published in journals including Nature Communications, Cell Metabolism, Nature Aging, Cell Reports, Theranostics, Journal of Controlled Release, Cancer Letters, and Oncotarget. Associated research fields encompass stem cell biology, multiple cancer types (prostate, breast, bladder, colorectal, lung), osteogenesis and bone biology, neural development, epithelial-mesenchymal transition, and inflammatory signaling pathways.

SpeciesApplicationTitle
mouseWB

Cell Metab

Mitochondrial Dynamics Is Critical for the Full Pluripotency and Embryonic Developmental Potential of Pluripotent Stem Cells.

Authors - Xiuying Zhong
mouse,humanIF

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

Authors - Yifei Cheng
WB

Bioact Mater

A tantalum-containing zirconium-based metallic glass with superior endosseous implant relevant properties

Authors - Yunshu Wu
humanWB

Nat Commun

ICAM1 initiates CTC cluster formation and trans-endothelial migration in lung metastasis of breast cancer.

Authors - Rokana Taftaf
mouseIF

Theranostics

Single-cell Transcriptome Profiling reveals Dermal and Epithelial cell fate decisions during Embryonic Hair Follicle Development.

Authors - Wei Ge
humanIF

J Control Release

Stepwise dual-release microparticles of BMP-4 and SCF in induced pluripotent stem cell spheroids enhance differentiation into hematopoietic stem cells

Authors - Alvin Bacero Bello

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer rated this antibody 4/5 stars, using it for Western Blot and Immunofluorescence on mouse liver tissue. For IF, they diluted it 1:200 in 1X PBS with overnight incubation at 4°C. For WB, a 1:1000 dilution in 1X TBST was used. The reviewer reported satisfactory performance in both applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kamal (Verified Customer) (10-16-2025)

For immunofluorescence, antibody was diluted in 1X PBS and incubated overnight at 4 degree celcius. For western blot, antibody was diluted 1:1000 in 1X TBST.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:200 (IFC), 1:1000 (WB)
  • Cell Tissue Type: Mouse Liver tissue
Loading...
||
New chat

Able™

正在加载,请稍候...