×
Use Able AI chat for product recommendations

RAPGEF5 Polyclonal antibody

RAPGEF5 Polyclonal Antibody for WB, IP, ELISA

Cat No. 12556-1-AP
Publications (1)
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, RIP, ELISA

Synonyms

M-Ras-regulated Rap GEF, Rap guanine nucleotide exchange factor 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using RAPGEF5 Polyclonal antibody (12556-1-AP)

    WB analysis using 12556-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of human brain tissue using RAPGEF5 Polyclonal antibody (12556-1-AP)

    WB analysis of human brain using 12556-1-AP

    human brain tissue were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of human brain tissue using RAPGEF5 Polyclonal antibody (12556-1-AP)

    WB analysis of human brain using 12556-1-AP

    human brain tissue were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HeLa cells using RAPGEF5 Polyclonal antibody (12556-1-AP)

    WB analysis of HeLa using 12556-1-AP

    HeLa cells were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HEK-293 cells using RAPGEF5 Polyclonal antibody (12556-1-AP)

    WB analysis of HEK-293 using 12556-1-AP

    HEK-293 cells were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of K-562 cells using RAPGEF5 Polyclonal antibody (12556-1-AP)

    WB analysis of K-562 using 12556-1-AP

    K-562 cells were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of mouse brain tissue using RAPGEF5 Polyclonal antibody (12556-1-AP)

    WB analysis of mouse brain using 12556-1-AP

    mouse brain tissue were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of K-562 cells using RAPGEF5 Polyclonal antibody (12556-1-AP)

    IP experiment of K-562 using 12556-1-AP

    IP result of anti-RAPGEF5 (IP:12556-1-AP, 4ug; Detection:12556-1-AP 1:500) with K-562 cells lysate 1760 ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for RAPGEF5 in ?

Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, human brain tissue, K-562 cells, mouse brain tissue
Positive IP detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12556-1-AP targets RAPGEF5 in WB, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3229

Product name: Recombinant human RAPGEF5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 129-444 aa of BC039203

Sequence: KKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSYVSVKAKVSSIAQEILLCSQLGKRVQLVKKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMKPPKIPFVPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV

Predict reactive species
Full Name Rap guanine nucleotide exchange factor (GEF) 5
Calculated Molecular Weight68 kDa
Observed Molecular Weight 68-75 kDa
GenBank Accession NumberBC039203
Gene Symbol RAPGEF5
Gene ID (NCBI) 9771
RRIDAB_2177476
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92565
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IP protocol for RAPGEF5 antibody 12556-1-APDownload protocol
WB protocol for RAPGEF5 antibody 12556-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RAPGEF5 Polyclonal antibody (Cat# 12556-1-AP) has 1 total citation. It appears in Redox Biology (IF 16.2), published in September 2022. The cited study investigated how circRAPGEF5 interacts with RBFOX2 to confer ferroptosis resistance by modulating alternative splicing of TFRC in endometrial cancer. The research fields associated with this citation include ferroptosis, RNA processing/alternative splicing, and endometrial cancer biology. The antibody was used for WB and RIP applications in human samples.

Automatically generated from the 1 publication citations by Able AI.
SpeciesApplicationTitle
humanWB,RIP

Redox Biol

CircRAPGEF5 interacts with RBFOX2 to confer ferroptosis resistance by modulating alternative splicing of TFRC in endometrial cancer

Authors - Jun Zhang
View Article
||
New chat

Able™

正在加载，请稍候...