Tested Applications
| Positive WB detected in | HCT 116 cells, HepG2 cells, MCF-7 cells, L02 cells, MDA-MB-231 cells |
| Positive IHC detected in | rat heart tissue, mouse intestine Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13120-1-AP targets TEAD3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3875 Product name: Recombinant human TEAD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-324 aa of BC027877 Sequence: MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD Predict reactive species |
| Full Name | TEA domain family member 3 |
| Calculated Molecular Weight | 435 aa, 49 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC027877 |
| Gene Symbol | TEAD3 |
| Gene ID (NCBI) | 7005 |
| RRID | AB_2203068 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99594 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TEAD3, others named ranscriptional enhancer factor 5(TEF5), a member of family of transcription factors that plays a key role in the Hippo signaling pathway, suggesting involve in organ and tumor suppression by restricting proliferation and promoting. TEAD3 contains the TEA/ATTS DNA-binding domain. Human TEAD3 has a strong mRNA expression in placenta and choriocarcinoma cells(JEG-3), but low in Hela, HepG2 and MCF-7. This is a rabbit polyclonal anti-TEAD3 antibody raised against part of C-terminal chain of human TEAD3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TEAD3 antibody 13120-1-AP | Download protocol |
| IHC protocol for TEAD3 antibody 13120-1-AP | Download protocol |
| WB protocol for TEAD3 antibody 13120-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TEAD3 Polyclonal antibody (Cat# 13120-1-AP) has 11 citations spanning journals including Cell Stem Cell, Nature Communications, Advanced Science, Science Advances, Cell Death & Disease, J Med Chem, J Cell Biology, J Gastroenterology, and Research Square. Research fields cover brain evolution, osteoporosis and bone metastasis, cardiac hypertrophy, exosome-mediated tissue regeneration, TEAD degraders/PROTACs, nasopharyngeal carcinoma, prostate cancer immune escape, muscle fiber type conversion, and primary biliary cholangitis.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Molecular signature of primate astrocytes reveals pathways and regulatory changes contributing to human brain evolution | ||
Adv Sci (Weinh) Discovery of a Potent and Selective TEAD Degrader with Durable Degradation Activity. | ||
Adv Sci (Weinh) SUMOylation of TEAD1 Modulates the Mechanism of Pathological Cardiac Hypertrophy | ||
Adv Sci (Weinh) TEAD1 Enhances Exosome Secretion and Promotes Exosome-Mediated Tissue Regeneration. | ||
Reviews
What customers say
All three reviews are five-star ratings. Users report excellent performance across Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, and ChIP applications. The antibody is described as reliable, smooth-working, and easy to handle, with successful results at dilutions ranging from 1:500 to 1:1000. One reviewer highlighted it as a "saviour" for large-scale research projects, while others praised its consistent quality and straightforward usability. Overall, customers express strong satisfaction with the product's versatility and performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (09-03-2026) | great antibody, very helpful!
|
Mounika (Verified Customer) (03-23-2026) | This antibody was our saviour for the big experiments for our research projects, no issues, smooth work!
|
Mounika (Verified Customer) (03-23-2026) | excellent antibody especially for western and immunofluorescence , thoroughly enjoyed and easy to work with it!
|
