×
Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TDG Polyclonal antibody

TDG Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 13370-1-AP
Publications (13)
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

EC:3.2.2.29, G/T mismatch-specific thymine DNA glycosylase, hTDG, thymine DNA glycosylase, Thymine-DNA glycosylase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using TDG Polyclonal antibody (13370-1-AP)

    WB analysis using 13370-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HEK-293 cells using TDG Polyclonal antibody (13370-1-AP)

    WB analysis of HEK-293 using 13370-1-AP

    WB result of TDG antibody (13370-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TDG transfected HEK-293 cells.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of human brain tissue using TDG Polyclonal antibody (13370-1-AP)

    WB analysis of human brain using 13370-1-AP

    human brain tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of mouse thymus tissue using TDG Polyclonal antibody (13370-1-AP)

    WB analysis of mouse thymus using 13370-1-AP

    mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HeLa cells using TDG Polyclonal antibody (13370-1-AP)

    WB analysis of HeLa using 13370-1-AP

    HeLa cells were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of mouse colon tissue using TDG Polyclonal antibody (13370-1-AP)

    WB analysis of mouse colon using 13370-1-AP

    mouse colon tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of Raji cells using TDG Polyclonal antibody (13370-1-AP)

    WB analysis of Raji using 13370-1-AP

    Raji cells were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of U-937 cells using TDG Polyclonal antibody (13370-1-AP)

    IP experiment of U-937 using 13370-1-AP

    IP result of anti-TDG (IP:13370-1-AP, 3ug; Detection:13370-1-AP 1:400) with U-937 cells lysate 3000ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using TDG Polyclonal antibody (13370-1-AP)

    IF Staining of HeLa using 13370-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 13370-1-AP (TDG antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for TDG in ?

Tested Applications

Positive WB detected inCaco-2 cells, HEK-293 cells, HeLa cells, human brain tissue, mouse colon tissue, mouse thymus tissue, Raji cells, HCT-116 cells, Jurkat cells, K-562 cells, MCF-7 cells
Positive IP detected inU-937 cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13370-1-AP targets TDG in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4190

Product name: Recombinant human TDG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-410 aa of BC037557

Sequence: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

Predict reactive species
Full Name thymine-DNA glycosylase
Calculated Molecular Weight 410 aa, 46 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC037557
Gene Symbol TDG
Gene ID (NCBI) 6996
RRIDAB_2271704
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13569
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TDG belongs to the TDG/mug DNA glycosylase family. TDG corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation (PMID:20696907). TDG is modified by SUMO-1 and SUMO-2/3.The molecular weight of non-modified TDG is 46 kDa and modified TDG is 55-60 kDa.

Protocols

Product Specific Protocols
IF protocol for TDG antibody 13370-1-APDownload protocol
IP protocol for TDG antibody 13370-1-APDownload protocol
WB protocol for TDG antibody 13370-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The TDG Polyclonal antibody (Cat# 13370-1-AP) has 13 citations spanning journals including Nature, Nature Chemical Biology, PNAS, Cell Death & Disease, Cell Death Discovery, International Journal of Biological Sciences, Journal of Cell Biology, Journal of Biological Chemistry, Cancer Science, Cell Molecular Biology Letters, and bioRxiv. Research fields encompass DNA damage repair, active DNA demethylation, R-loop biology, Wnt signaling, oxidative stress, and cancer biology (thyroid, colon, glioma, hepatocellular, and colorectal cancers). Applications include WB, IHC, ChIP, and IP.

Automatically generated from the 13 publication citations by Able AI.
SpeciesApplicationTitle
humanWB

Nature

Human HDAC6 senses valine abundancy to regulate DNA damage

Authors - Jiali Jin
View Article
mouseIHC

Nat Chem Biol

Targeting thymine DNA glycosylase induces synthetic lethality in p53-deficient cancers.

Authors - Jia-Xin Zhou
View Article
humanWB

Cell Death Dis

The HOTAIRM1/miR-107/TDG axis regulates papillary thyroid cancer cell proliferation and invasion.

Authors - Dan Li
View Article
humanWB

Cell Mol Biol Lett

Hypoxia-induced genome-wide DNA demethylation by DNMT3A and EMT of cancer cells

Authors - Biswanath Chatterjee
View Article
humanWB

Int J Biol Sci

TDG suppresses the migration and invasion of human colon cancer cells via the DNMT3A/TIMP2 axis.

Authors - Jiyu Miao
View Article
humanIHC,ChIP

Cell Death Discov

TNC upregulation promotes glioma tumourigenesis through TDG-mediated active DNA demethylation

Authors - Hongyu Xu
  • KO Validated
View Article
||
New chat

Able®

正在加载，请稍候...