PHACTR4 Polyclonal antibody

PHACTR4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13408-1-AP

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PRO2963

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of mouse eye using 13408-1-AP
mouse eye tissue were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human liver using 13408-1-AP
human liver tissue were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of A431 using 13408-1-AP
A431 cells were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat ovary using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat lung using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat ovary using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 13408-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of A431 using 13408-1-AP
Immunofluorescent analysis of A431 cells using 13408-1-AP (PHACTR4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PHACTR4 in ?

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse eye tissue, A431 cells, human liver tissue
Positive IHC detected in	human ovary cancer tissue, human placenta tissue, rat lung tissue, rat ovary tissue, mouse ovary tissue, mouse lung tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	A431 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13408-1-AP targets PHACTR4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4054 Product name: Recombinant human PHACTR4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 403-702 aa of BC029266 Sequence: FGEPHIPSRLPPLPLHIRIQQALTSPLPMTPILEGSHRAHSLLFENSDSFSEDSSTLGRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSEPELNLNSWPCKSKEEWNEIRHQIGNTLIRRLSQRPTPEELEQRNILQPKNEADRQAEKREIKRRLTRKLSQRPTVAELLARKILRFNEYVEVTDAQDYDRRADKPWTKLTPADKAAIRKELNEFKSSEMEVHEESKHFTRYHRP Predict reactive species
Full Name	phosphatase and actin regulator 4
Calculated Molecular Weight	702 aa, 78 kDa
Observed Molecular Weight	71-78 kDa
GenBank Accession Number	BC029266
Gene Symbol	PHACTR4
Gene ID (NCBI)	65979
RRID	AB_10638316
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8IZ21
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for PHACTR4 antibody 13408-1-AP	Download protocol
IHC protocol for PHACTR4 antibody 13408-1-AP	Download protocol
WB protocol for PHACTR4 antibody 13408-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Phactr4 antibody (Cat# 13408-1-AP) has 2 total citations. These appear in Redox Biology (IF 16.2) and International Journal of Biological Macromolecules (IF 8.7). Both studies used the antibody for Western blot in mouse models, investigating Phactr4's role in chronic stress-induced behavioral disorders, oxidative stress, neuroinflammation, and neuroplasticity—placing the research firmly in the fields of neuroscience and stress-related psychiatric disorders.

Species	Application	Title
mouse	WB	Redox Biol Phactr4 promotes oxidative stress and behavioral disorder caused by chronic stress via regulating PP1/GSK3-β pathway. Authors - Tian Lan KD Validated View Article
mouse	WB	Int J Biol Macromol Targeting Phactr4 to rescue chronic stress-induced depression-like behavior in rats via regulating neuroinflammation and neuroplasticity Authors - Ye Li View Article