Tested Applications
| Positive WB detected in | human liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13770-1-AP targets TRAK2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4753 Product name: Recombinant human TRAK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC040668 Sequence: MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWTQSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELVRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRS Predict reactive species |
| Full Name | trafficking protein, kinesin binding 2 |
| Calculated Molecular Weight | 914 aa, 101 kDa |
| Observed Molecular Weight | 101-106 kDa |
| GenBank Accession Number | BC040668 |
| Gene Symbol | TRAK2 |
| Gene ID (NCBI) | 66008 |
| RRID | AB_2207961 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60296 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Trafficking kinesin-binding protein 2 (TRAK2) is a member of the TRAK family of kinesin adaptor proteins. In mammals, there are two members of the TRAK family, TRAK1 and TRAK2 (PMID: 25653102). TRAK1 and TRAK2 play roles in lysosomal and mitochondrial trafficking in cells. They function as kinesin adaptors linking kinesin heavy chain (KHC) to mitochondria (PMID: 28364549). TRAK2 has been found to act as a trafficking factor for the K+ channel Kir2.1 and γ-Aminobutyric acid type A (GABAA) receptor (PMID: 16895905; 24122114).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| IHC protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| IP protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| WB protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TRAK2 Polyclonal antibody (Cat# 13770-1-AP) has 8 citations published in Science, Nature Communications, Science Advances, Bioengineering and Translational Medicine, FASEB Journal, BMC Cancer, Journal of Cell Science, and Experimental Cell Research. The associated research fields include mitochondrial trafficking and dynamics, mitochondrial transplantation in spinal cord injury, Alzheimer's disease, esophageal squamous cell carcinoma metastasis, and epilepsy.
| Species | Application | Title |
|---|---|---|
Science A molecular switch for coordinating kinesin and dynein transport of mitochondrial cargo | ||
Nat Commun mRNA trafficking directs cell-size-scaling of mitochondria distribution and function.
| ||
Sci Adv ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution | ||
Bioeng Transl Med Photobiomodulation augments the effects of mitochondrial transplantation in the treatment of spinal cord injury in rats by facilitating mitochondrial transfer to neurons via Connexin 36 | ||
FASEB J Adaptation of mitochondrial network dynamics and velocity of mitochondrial movement to chronic stress present in fibroblasts derived from patients with sporadic form of Alzheimer's disease. | ||
BMC Cancer CircSLC22A3 inhibits the invasion and metastasis of ESCC via the miR-19b-3p/TRAK2 axis and by reducing the stability of m6A-modified ACSBG1 mRNA |
