ACBD3 Polyclonal antibody

ACBD3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14096-1-AP

Publications(5)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

Acyl-CoA-binding domain-containing protein 3, GCP60, GOCAP1, Golgi complex-associated protein 1, Golgi phosphoprotein 1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 14096-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 14096-1-AP (ACBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse testis using 14096-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 14096-1-AP (ACBD3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse ovary using 14096-1-AP
mouse ovary tissue were subjected to SDS PAGE followed by western blot with 14096-1-AP (ACBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat ovary using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat ovary using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 14096-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 14096-1-AP
Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 14096-1-AP (ACBD3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (5)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293T cells, mouse ovary tissue, mouse testis tissue
Positive IHC detected in	mouse testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14096-1-AP targets ACBD3 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag5228 Product name: Recombinant human ACBD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 229-528 aa of BC060792 Sequence: RRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANRPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR Predict reactive species
Full Name	acyl-Coenzyme A binding domain containing 3
Calculated Molecular Weight	528 aa, 61 kDa
Observed Molecular Weight	60-70 kDa
GenBank Accession Number	BC060792
Gene Symbol	ACBD3
Gene ID (NCBI)	64746
RRID	AB_2220062
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H3P7
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for ACBD3 antibody 14096-1-AP	Download protocol
IHC protocol for ACBD3 antibody 14096-1-AP	Download protocol
WB protocol for ACBD3 antibody 14096-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
		Infect Immun Chlamydia pneumoniae facilitates its development by recruiting PI4P to inclusion bodies via the Cpn0308-ACBD3-PI4KB pathway. Authors - Xiaonan Feng View Article
human	IF	J Bacteriol The Chlamydia pneumoniae inclusion membrane protein Cpn0308 interacts with host protein ACBD3 Authors - Liang Ma View Article
mouse	WB,CoIP	Transl Psychiatry Critical role of translocator protein (TSPO) in neuronal mitochondrial dysfunction and mental stress-exacerbated ischemic injury following stroke. Authors - Yuequan Zhu View Article
human	WB	Cell Biol Int Golgi protein ACBD3 downregulation sensitizes cells to ferroptosis Authors - Ying Qian KD Validated View Article
		Int Immunopharmacol HO-1 alleviates lipopolysaccharide-induced acute lung injury in mice by downregulating TFE3 expression and nuclear translocation and suppressing Golgi stress response. Authors - Xiangyun Li View Article