Tested Applications
| Positive WB detected in | Raji cells, human placenta tissue, human spleen tissue, A431 cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human tonsillitis tissue, human placenta tissue, human skin cancer tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14670-1-AP targets HLA-F in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6335 Product name: Recombinant human HLA-F protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-298 aa of BC062991 Sequence: AGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQS Predict reactive species |
| Full Name | major histocompatibility complex, class I, F |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | BC062991 |
| Gene Symbol | HLA-F |
| Gene ID (NCBI) | 3134 |
| RRID | AB_1519280 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30511 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-F is a non-classical MHC class I molecule. (PMID: 667938; 3375250; 2249951)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HLA-F antibody 14670-1-AP | Download protocol |
| IP protocol for HLA-F antibody 14670-1-AP | Download protocol |
| WB protocol for HLA-F antibody 14670-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HLA-F antibody (Cat# 14670-1-AP) has 11 total citations. These appear in journals including Kidney International, International Journal of Biological Sciences, Frontiers in Immunology, Lung Cancer, International Journal of Cancer, Journal of Immunology, Viruses, Human Immunology, Oncology Letters, Pathology International, and Journal of Surgical Research. The research fields span immunology, oncology (lung, esophageal, gastric, hepatocellular, breast, and glioma cancers), virology, and reproductive biology.
| Species | Application | Title |
|---|---|---|
Kidney Int Upregulation of HLA-F expression by BK polyomavirus infection induces immune recognition by KIR3DS1-positive natural killer cells. | ||
Int J Biol Sci Targeting HLA-F suppresses the proliferation of glioma cells via a reduction in hexokinase 2-dependent glycolysis.
| ||
Front Immunol Single-Cell RNA Sequencing Unravels Distinct Tumor Microenvironment of Different Components of Lung Adenocarcinoma Featured as Mixed Ground-Glass Opacity | ||
Lung Cancer HLA-F expression is a prognostic factor in patients with non-small-cell lung cancer. | ||
Int J Cancer Alteration of HLA-F and HLA I antigen expression in the tumor is associated with survival in patients with esophageal squamous cell carcinoma. | ||
J Immunol Immune Modifications in Fetal Membranes Overlying the Cervix Precede Parturition in Humans. |
