Tested Applications
| Positive WB detected in | Tunicamycin treated HeLa cells, MCF-7 cells, HeLa cells, K-562 cells, RAW 264.7 cells |
| Positive IP detected in | C6 cells |
| Positive IHC detected in | human colon cancer tissue, human breast cancer tissue, human thyroid cancer tissue, human cervical cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Tunicamycin treated HeLa cells, thapsigargin treated U2OS cells |
| Positive FC (Intra) detected in | Tunicamycin treated HeLa cells |
Samples need to be treated with ER stress.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15204-1-AP targets CHOP/GADD153 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7354 Product name: Recombinant human CHOP; GADD153 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC003637 Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA Predict reactive species |
| Full Name | DNA-damage-inducible transcript 3 |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC003637 |
| Gene Symbol | CHOP |
| Gene ID (NCBI) | 1649 |
| RRID | AB_2292610 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35638 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CHOP/GADD153 antibody 15204-1-AP | Download protocol |
| IHC protocol for CHOP/GADD153 antibody 15204-1-AP | Download protocol |
| IP protocol for CHOP/GADD153 antibody 15204-1-AP | Download protocol |
| WB protocol for CHOP/GADD153 antibody 15204-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CHOP/GADD153 Polyclonal antibody (Cat# 15204-1-AP) has 889 total citations. Publications appear in high-impact journals including Nature, Science, Cell, Nature Communications, Nature Cell Biology, Autophagy, Cell Death & Disease, Cell Death & Discovery, Redox Biology, Molecular Cell, Oncogene, and Free Radical Biology & Medicine. Research fields span endoplasmic reticulum (ER) stress, the unfolded protein response, autophagy, apoptosis, ferroptosis, cancer, neurodegeneration, diabetes, and cardiovascular disease.
| Species | Application | Title |
|---|---|---|
Science Endosomal lipid signaling reshapes the endoplasmic reticulum to control mitochondrial function | ||
Adv Mater Poly(Citric Acid) Bidirectional Regulator: Coordinating Iron Homeostasis to Suppress Stress Responses and Boosting Mitochondrial Bioenergetics for Enhanced Nerve Repair. | ||
Cancer Commun (Lond) HMMR alleviates endoplasmic reticulum stress by promoting autophagolysosomal activity during endoplasmic reticulum stress-driven hepatocellular carcinoma progression |
Reviews
What customers say
Customers consistently rate this antibody 4–5 stars across Western blot, IHC, and protein purification. Reviewers highlight clean, specific bands at the expected molecular weight, high sensitivity with low background, and reliable signal in cell lines (HEK293T, HCT116) and tissues (mouse retina, kidney). One user noted strong stress-inducible expression. Dilutions of 1:100–1:1000 were commonly used. Overall, the antibody is described as performing as expected with excellent specificity and reproducibility across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Yue (Verified Customer) (02-25-2026) | The antibody works great! Very clean bands.
|
Danyan (Verified Customer) (10-02-2025) | Performed as expected, with high sensitivity and low background across multiple applications.
|
Morgane (Verified Customer) (09-15-2025) | Very specific, good signal, stress inductible
 |
Fan (Verified Customer) (03-22-2021) | Mouse retinal tissue was used. Single band detected at the right size.
 |
Daniel (Verified Customer) (06-25-2019) | Specific staining detected in the proximal tubules.
 |
