Tested Applications
| Positive WB detected in | HEK-293 cells, rat lung tissue, mouse lung tissue, RAW 264.7 cells |
| Positive IP detected in | mouse lung tissue |
| Positive IHC detected in | human tonsillitis tissue, mouse spleen tissue, mouse cerebellum tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15361-1-AP targets Beta Arrestin 1 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7608 Product name: Recombinant human Arrestin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 69-418 aa of BC003636 Sequence: DVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR Predict reactive species |
| Full Name | arrestin, beta 1 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 47-55 kDa |
| GenBank Accession Number | BC003636 |
| Gene Symbol | Beta Arrestin 1 |
| Gene ID (NCBI) | 408 |
| RRID | AB_2060227 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49407 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
β-Arrestins (ARRBs), the best known regulators of G protein-coupled receptor signaling, are versatile and multifunctional adapter proteins that regulate diverse cellular functions, including cell growth, apoptosis and immune responses. Overexpression of beta Arrestin 1 has been found in various cancers, indicating it as a potential therapeutic target for cancer treatment. Recently expression of ARRB1 in saliva has been identified as a candidate circadian biomarker. ARRB1 migrated as a doublet of two bands of 45 and 55 kDa (PMID:28947386).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Beta Arrestin 1 antibody 15361-1-AP | Download protocol |
| IP protocol for Beta Arrestin 1 antibody 15361-1-AP | Download protocol |
| WB protocol for Beta Arrestin 1 antibody 15361-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
15361-1-AP (β-Arrestin antibody) has 17 citations across 16 journals including Cell Metabolism, Hepatology, Cell Death & Disease, PNAS, Frontiers in Immunology, and Biochemical Pharmacology. Research fields span glucose metabolism, liver fibrosis, lung and colorectal cancer, diabetic nephropathy, GPCR signaling, vascular biology, neuroinflammation, kidney injury, and radiation response, with applications in WB, IF, IP, CoIP, IHC, and ChIP.
| Species | Application | Title |
|---|---|---|
Cell Metab Autonomous sensing of the insulin peptide by an olfactory G protein-coupled receptor modulates glucose metabolism.
| ||
Hepatology Hepatocyte-derived MASP1-enriched small extracellular vesicles activate HSCs to promote liver fibrosis | ||
Cell Death Dis PLEKHH2 binds β-arrestin1 through its FERM domain, activates FAK/PI3K/AKT phosphorylation, and promotes the malignant phenotype of non-small cell lung cancer | ||
Cell Death Dis β-Arrestins promote podocyte injury by inhibition of autophagy in diabetic nephropathy. | ||
Proc Natl Acad Sci U S A α-fluoro-β-alanine functions as a β-arrestin1-biased ligand of S1PR2 to upregulate DPD expression in cancer cells | ||
Front Immunol Identification and validation of chemokine system-related genes in idiopathic pulmonary fibrosis |
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application on endothelial cells using a 1:1000 dilution. The reviewer described it as a great antibody that has consistently worked without any need for troubleshooting or optimization, indicating reliable and reproducible performance out of the box.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lily (Verified Customer) (03-19-2026) | Great antibody! Has always worked without any troubleshooting and optimization.
|
