Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue, mouse spinal cord tissue |
| Positive IHC detected in | mouse cerebellum tissue, rat cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15371-1-AP targets GLRB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4429 Product name: Recombinant human GLRB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 17-267 aa of BC032635 Sequence: VEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVG Predict reactive species |
| Full Name | glycine receptor, beta |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC032635 |
| Gene Symbol | GLRB |
| Gene ID (NCBI) | 2743 |
| RRID | AB_2878132 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48167 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GLRB antibody 15371-1-AP | Download protocol |
| WB protocol for GLRB antibody 15371-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GLRB Polyclonal antibody (Cat# 15371-1-AP) has 3 citations. They appear in PLoS Biology, Journal of Neuroscience, and Psychopharmacology (Berl). The research fields span glycine receptor signaling in the spinal dorsal horn, synaptic plasticity involving GlyRβ release and endocytosis, and the role of skeletal muscle glycine in ketamine's rapid antidepressant effects in an inflammation-induced mouse depression model. All three studies used the antibody for Western blot in mouse samples.
| Species | Application | Title |
|---|---|---|
PLoS Biol mGluR5/ERK signaling regulated the phosphorylation and function of glycine receptor α1ins subunit in spinal dorsal horn of mice. | ||
J Neurosci Spinal cord synaptic plasticity by GlyRβ release from receptor fields and syndapin I-dependent uptake | ||
Psychopharmacology (Berl) Contribution of skeletal muscular glycine to rapid antidepressant effects of ketamine in an inflammation-induced mouse model of depression. |
Reviews
What customers say
The single review for 15371-1-AP is a 5-star rating from November 2019. The reviewer used the antibody for immunofluorescence on 4% PFA-fixed rat DRG slices at a 1:1000 dilution, paired with Alexa 555 secondary antibody at 1:1000. The result was satisfactory, demonstrating clear staining of GlyRB in rat dorsal root ganglion tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
A (Verified Customer) (11-11-2019) | Immunofluorescent analysis of (4% PFA) fixed rat DRG slices using GlyRB rabbit polyclonal antibody at 1:1000 dilution and Alexa 555 at 1:1000 dilution.
 |
