Tested Applications
| Positive WB detected in | A549 cells, human brain tissue, Hela cells |
| Positive IHC detected in | human liver tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15728-1-AP targets NDUFS7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8471 Product name: Recombinant human NDUFS7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC005954 Sequence: MAVLSAPGLRGFRILGLRSSVGLAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) |
| Calculated Molecular Weight | 213 aa, 24 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC005954 |
| Gene Symbol | NDUFS7 |
| Gene ID (NCBI) | 374291 |
| RRID | AB_2149029 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75251 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFS7(NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial) protein is one of the most conserved subunits of mitochondrial respiratory chain complex I and plays a central role in the interaction with the electron acceptor ubiquinone and in the proton-translocating mechanism(PMID:15269216).Defects in NDUFS7 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NDUFS7 antibody 15728-1-AP | Download protocol |
| IHC protocol for NDUFS7 antibody 15728-1-AP | Download protocol |
| WB protocol for NDUFS7 antibody 15728-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NDUFS7 Polyclonal antibody (Cat# 15728-1-AP) has 19 citations spanning journals including Science, Cell Research, Cancer Discovery, Molecular Cell, JCI, Cell Chemical Biology, FEBS J, Neurochemistry International, Antioxidants & Redox Signaling, and Translational Neurodegeneration. Research fields cover mitochondrial complex I biology, cancer metabolism, neurodegeneration, iron homeostasis, ferroptosis, oxidative stress, and metabolic reprogramming. Applications cited include WB, IHC, IF, and IP in human and mouse models.
| Species | Application | Title |
|---|---|---|
Cell Res NDUFAB1 confers cardio-protection by enhancing mitochondrial bioenergetics through coordination of respiratory complex and supercomplex assembly. | ||
Cancer Discov Coordinated Transcriptional and Catabolic Programs Support Iron-Dependent Adaptation to RAS-MAPK Pathway Inhibition in Pancreatic Cancer | ||
Transl Neurodegener Deficient AMPK-SENP1-Sirt3 signaling impairs mitochondrial complex I function in Parkinson's disease model | ||
Mol Cell Maintaining Iron Homeostasis Is the Key Role of Lysosomal Acidity for Cell Proliferation. | ||
J Clin Invest miR-142 controls metabolic reprogramming that regulates dendritic cell activation. |
Reviews
What customers say
All three reviews are for Western Blot on human fibroblasts at a 1:1000 dilution. Users consistently report a clear, specific band at the expected molecular weight. One reviewer highlighted the well-defined band and explicitly recommended the product. Overall, the antibody performs reliably with good specificity in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Matthieu (Verified Customer) (09-24-2025) | Band visible at expected size
|
Manon (Verified Customer) (09-23-2025) | Good specific band
|
Emilie (Verified Customer) (07-23-2025) | Used for Western blot on human fibroblasts and gives a clear, well-defined band. I recommend this product.
|
