Tested Applications
| Positive WB detected in | A549 cells, human milk, mouse lung tissue, Jurkat cells, human placenta tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15804-1-AP targets GLRX in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8535 Product name: Recombinant human GLRX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC005304 Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ Predict reactive species |
| Full Name | glutaredoxin (thioltransferase) |
| Calculated Molecular Weight | 106 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC005304 |
| Gene Symbol | GLRX |
| Gene ID (NCBI) | 2745 |
| RRID | AB_11232210 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35754 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GLRX antibody 15804-1-AP | Download protocol |
| WB protocol for GLRX antibody 15804-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GLRX Polyclonal antibody (Cat# 15804-1-AP) has 17 citations published in journals including Acta Pharm Sin B, Biomaterials, J Pharm Anal, Free Radic Biol Med, Antioxidants, Biochem Pharmacol, Eur J Pharmacol, Sci Rep, Biomedicines, J Bioenerg Biomembr, Exp Cell Res, Neuroreport, Mol Vis, and eLife. Research fields span oxidative stress and S-glutathionylation, diabetes/glucose metabolism, cardiovascular disease, neuroprotection, ferroptosis, liver injury, bone regeneration, and immune regulation.
| Species | Application | Title |
|---|---|---|
Acta Pharm Sin B Dihydrotanshinone I preconditions myocardium against ischemic injury via PKM2 glutathionylation sensitive to ROS | ||
Biomaterials Modeling calcific aortic valve disease with engineered human valve tissues identifies SAMHD1 as a therapeutic target. | ||
J Pharm Anal Naringenin boosts Parkin-mediated mitophagy via estrogen receptor alpha to maintain mitochondrial quality control and heal diabetic foot ulcer. | ||
J Pharm Anal Glutaredoxin-1 alleviates acetaminophen-induced liver injury by decreasing its toxic metabolites | ||
Antioxidants (Basel) Glutathione Induces Keap1 S-Glutathionylation and Mitigates Oscillating Glucose-Induced β-Cell Dysfunction by Activating Nrf2 | ||
Free Radic Biol Med Hydrogen sulfide improves endothelial barrier function by modulating the ubiquitination degradation of KLF4 through TRAF7 S-sulfhydration in diabetic aorta |
